| Protein: 110766823 XP_001120524.1 PREDICTED: 40S ribosomal protein S20 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 33.4 | 28.3 | 38.3 | 0.8720627 | 0.7389034 |
| Scape | 48.8 | 17.6 | 33.6 | 1.4523809 | 0.52380955 |
| Brain | 46.4 | 53.6 | 0.86567163 | ||
| Crop | 50.5 | 49.5 | 1.020202 | ||
| Eye | 42.6 | 57.4 | 0.74216026 | ||
| Intestine | 23.5 | 39.5 | 37 | 0.6351351 | 1.0675676 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 48.9 | 14.7 | 36.4 | 1.3434066 | 0.40384614 |
| Salivary gland, thoracic | 28.6 | 32.3 | 39.1 | 0.7314578 | 0.82608694 |
| Sternite | 34.8 | 32.6 | 32.6 | 1.0674846 | 1 |
| Tergite | 58.5 | 31.9 | 9.6 | 6.09375 | 3.3229167 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 36.4 | 35.7 | 28 | 1.3 | 1.275 |
| Malpighian tubules | 41.6 | 23.9 | 34.5 | 1.2057971 | 0.6927536 |
| Nerve chord | 44.9 | 14.3 | 40.8 | 1.1004902 | 0.35049018 |
| Poison sac | |||||
| Sting | 46.7 | 53.3 | 0.8761726 | ||
| Heart | 13.8 | 50 | 36.2 | 0.38121548 | 1.3812155 |
| Hypopharyngeal gland | 4.1 | 95.9 | 0.04275287 | ||
| Galea | 43.8 | 56.2 | 0.77935946 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38 | 32 | 43.1 | 0.88167053 | 0.7424594 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MASTKVDNPEKPGQEVTPIHRIRITLTSRNVRSLEKVCSELINGANKQKLKVKGPVRMPT KILRITTRKTPCGEGSKTWDRFQMRIHKRVIDLYSPSEIVKQITSISIEPGVEVEVTIAN E |
 Top
| |