| Protein: 66533332 XP_625023.1 PREDICTED: mesencephalic astrocyte-derived neurotrophic factor homolog |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 40 | 35.5 | 24.5 | 1.6326531 | 1.4489796 |
| Scape | 28.5 | 51 | 20.5 | 1.3902439 | 2.487805 |
| Brain | 29.6 | 70.4 | 0.42045453 | ||
| Crop | 7.7* | 52.5 | 39.8 | 0.19346733 | 1.3190955 |
| Eye | 45.6 | 54.4 | 0.8382353 | ||
| Intestine | 35.1 | 40 | 24.9 | 1.4096385 | 1.6064258 |
| Leg, front | 38.5 | 37.8 | 23.8 | 1.617647 | 1.5882353 |
| Leg, middle | |||||
| Leg, rear | 56.3 | 43.7 | 1.2883295 | ||
| Mandibular gland | 3.3 | 78.2 | 18.5 | 0.17837837 | 4.227027 |
| Rectum | 47.9 | 52.1 | 0.9193858 | ||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 56.6 | 14.3 | 29.1 | 1.9450172 | 0.49140894 |
| Sternite | 25.7 | 41 | 33.3 | 0.7717718 | 1.2312312 |
| Tergite | 24.8 | 56.3 | 18.8 | 1.3191489 | 2.994681 |
| Ventriculus | 27.3 | 39.3 | 33.4 | 0.8173653 | 1.1766467 |
| Thoracic muscle | |||||
| Fat body | 69.4 | 19.5 | 11.1 | 6.252252 | 1.7567568 |
| Malpighian tubules | 34.1 | 35.2 | 30.7 | 1.1107492 | 1.1465799 |
| Nerve chord | 55.1* | 25.6 | 19.4 | 2.8402061 | 1.3195876 |
| Poison sac | |||||
| Sting | |||||
| Heart | 35.8 | 40 | 24.2 | 1.4793389 | 1.6528926 |
| Hypopharyngeal gland | 39.4 | 60.6 | 0.650165 | ||
| Galea | 65 | 35 | 1.8571428 | ||
| Glossa | 28.7 | 41 | 30.3 | 0.9471947 | 1.3531353 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36 | 41.5 | 33.3 | 1.081081 | 1.2462462 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNNSVLLTLSIVIGLIYTVIALKNDECEVCINTVERFVNTLSEDVKIDTKKIEAAFKEFC KGTKSKENRFCYYLGGLEESATGILSELSKPISWSMPANKICEKLKKKDSQICDLRYEKQ IDINTVDLKKLKVRDLRKILSDWDETCDGCIEKTDFIKRIEELKPKYSHSAKSEL |
 Top
| |