| Protein: 66525345 XP_396922.2 PREDICTED: peroxisomal N(1)-acetyl-spermine/spermidine oxidase-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 26.4 | 55.2* | 18.4 | 1.4347826 | 3 |
| Scape | 18.3 | 47.9 | 33.8 | 0.5414201 | 1.4171598 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | 46.4 | 53.6 | 0.86567163 | ||
| Leg, rear | 67.6 | 32.4 | 2.0864198 | ||
| Mandibular gland | 20.5 | 79.5 | 0.25786164 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 17.8 | 63.9* | 18.3 | 0.9726776 | 3.4918032 |
| Sternite | 19.6 | 29.4 | 51.1 | 0.38356164 | 0.5753425 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | 76.4 | 23.6 | 3.2372882 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 23.9 | 52.8 | 23.3 | 1.0257511 | 2.2660944 |
| Hypopharyngeal gland | |||||
| Galea | 68.7* | 22.5 | 8.8 | 7.806818 | 2.5568182 |
| Glossa | 26.8 | 37.2 | 36 | 0.74444443 | 1.0333333 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.2 | 48 | 34.4 | 0.93604654 | 1.3953488 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLYCMIFLFCLISGTFSDDTKSPRIVIVGAGASGIAAAAKLIENGLENLIILEAENRIGG RVNTVKFDDYLVDLGAQWIHGEKGNVVYELVAPLNITDNSKPHDDEVYTSTGELIDTRIT KNLTDSYFNYLDSIEYITNNECYDSIGECFENKLKDDFTQFPELNETLQDQLLWLFNMMQ IGYDPADNWYDIAAKGYLEYEICKGDPAINWKERGYGTILDILMKKFPNPEEELPVLNKT ILNAEVTQVDYSSEDNIVKVTTLDGKEYIADHVIMTPSLGVLKEQHETLFNPPLSESKIR NIKAIGYGNACKIFLAFNDTWFNVKDTNKIGYRILWSKEERKKLDSNPKTRWMPYAVGFF FVEHKPRLLYVWVSGKGARLMDDVTDDEVFDQTVEMLYNLLSKNYNVSRPTAMIRSKWHE NKHFRGTYSYQSIETVKTNSSALQLSQPIMKKGKPIILFGGEATNKHYFSTVHGAIGSGW REAERLINLYDKNNRTINNI |
 Top
| |