| Protein: 328788234 XP_397543.4 PREDICTED: hypothetical protein LOC409060 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 38.2 | 23.2 | 38.6 | 0.9896373 | 0.60103625 |
| Brain | |||||
| Crop | 25.8 | 17.1 | 57.1 | 0.45183888 | 0.2994746 |
| Eye | |||||
| Intestine | 31.7 | 25 | 43.2 | 0.7337963 | 0.5787037 |
| Leg, front | 41.5 | 21.1 | 37.4 | 1.1096257 | 0.56417114 |
| Leg, middle | 43.2 | 16.7 | 40.2 | 1.0746269 | 0.4154229 |
| Leg, rear | |||||
| Mandibular gland | 69.5 | 30.5 | 2.2786884 | ||
| Rectum | 1.9 | 98.1 | 0.019367993 | ||
| Salivary gland, cerebral | 23.5 | 21.6 | 54.8 | 0.4288321 | 0.3941606 |
| Salivary gland, thoracic | 17.8 | 54.3 | 27.9 | 0.63799286 | 1.9462366 |
| Sternite | 86.5* | 7.7 | 5.8 | 14.913794 | 1.3275862 |
| Tergite | 96.5* | 1.5 | 2 | 48.25 | 0.75 |
| Ventriculus | |||||
| Thoracic muscle | 46.6 | 53.4 | 0.87265915 | ||
| Fat body | 76.2* | 21.3* | 2.5 | 30.48 | 8.52 |
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 20.1 | 79.9 | 0.25156444 | ||
| Heart | 75.2* | 6.9 | 17.9 | 4.2011175 | 0.38547486 |
| Hypopharyngeal gland | |||||
| Galea | 31.2 | 36.8 | 32 | 0.975 | 1.15 |
| Glossa | 27.7 | 42.2 | 30.1 | 0.9202658 | 1.4019934 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 48.7 | 21.2 | 38.3 | 1.2715405 | 0.5535248 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVYESDFYTTRRPYSRPLVSSYSITKQDYFPWEKVPFVPRPSLVPEPFTVWGRKRQDPKK EFYQYVTLRDKEGVVRGKNPSKEDHARQLVAGGAVSKDRPITLPISTILQLRSIPRMPYV AHKRLVTVIHIPYHTVYYGGTLIPIRVHSRVRPSVLAAELNRIRSLTRPSTESYVEKYLQ SKDHIYFDDEAREIRARVDSLLRRVHIFVPRAVASDFAEEIVPERMRSGDYVRRLLSGKH NMKKDSIEPISWYEVPDRGNFGNLACVKYVAGKPHSIRKPYFKVADLRPSDIKNDVNFLS YYSKNREAAANALRQDKEEAAKRIEQYLINAAEQARTEEERKIAAEEERTRLELEEAKAW EQLQIAQERVAHLDEIIEQEKTEEKRKAEEEKIEADLLETRKILEEERKLEEAKTAALLA EQERMLIEEQLEKTREEEEKEERLANVTFLEQEREVKSVDPCRDDEITCDVTDQDREEKP YDPITDDETQIEEEEAHEECECDMAENPFVEEPEGAEGKAVTGGNSVEESSKTEEATSGG EESFVWGDEED |
 Top
| |