| Protein: 66526686 XP_397213.2 PREDICTED: 39S ribosomal protein L47 mitochondrial isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 25.2 | 50.1 | 24.7 | 1.0202429 | 2.02834 |
| Scape | 67.9 | 32.1 | 2.115265 | ||
| Brain | |||||
| Crop | 48.6 | 51.4 | 0.9455253 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | 56.3 | 43.7 | 1.2883295 | ||
| Leg, middle | 48.3 | 51.7 | 0.934236 | ||
| Leg, rear | 42.2 | 57.8 | 0.7301038 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 51 | 21.2 | 27.8 | 1.8345324 | 0.76258993 |
| Sternite | 34.8 | 38.8 | 26.4 | 1.3181819 | 1.469697 |
| Tergite | 56 | 44 | 1.2727273 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 25.8 | 48.1 | 26.2 | 0.9847328 | 1.8358779 |
| Malpighian tubules | 46.9 | 22.9 | 30.2 | 1.5529802 | 0.75827813 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 48.8 | 17.9 | 33.3 | 1.4654654 | 0.5375375 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | 69.5 | 30.5 | 2.2786884 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 45.3 | 40.8 | 36.9 | 1.2276423 | 1.1056911 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAAFTKAMQVSKGVNNVTKLFTNLTLSQNVNSISIPIFIPRMPTFQCAFIHTTFKNNDLM EFFDDPKNWEKDKVRVGRSWRKDELRLKSNEELHKLWFVLLKERNMLLTMEEAYKKEWKY FPNPERIDKVEDSMSNLESVVRERNKAYHMLEIGTTGERPVELKYNALGIRSLYRLRQYS IPKYMNSAWHKKHQFGYGGYAVRKFLRLYREKLWNEKRKLRNRQNNQVATLIRIFPNLDM EAVKEQYPLANIEKIKRTRKSDGHYIRD |
 Top
| |