| Protein: 328783352 XP_001120243.2 PREDICTED: chymotrypsin inhibitor |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 73.2* | 26.8 | 2.7313433 | ||
| Scape | |||||
| Brain | |||||
| Crop | 20.5 | 79.5 | 0.25786164 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 51.1 | 17.8 | 31.1 | 1.6430868 | 0.5723473 |
| Sternite | 38.4 | 4.3* | 57.4 | 0.66898954 | 0.07491289 |
| Tergite | 9.7 | 32.6 | 57.7 | 0.16811092 | 0.56499135 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 19.3 | 18.1 | 62.7 | 0.307815 | 0.28867623 |
| Malpighian tubules | 6.3* | 27.6 | 66.1 | 0.09531014 | 0.41754916 |
| Nerve chord | 2* | 40.5 | 57.5 | 0.03478261 | 0.70434785 |
| Poison sac | 27.9 | 72.1 | 0.38696256 | ||
| Sting | 8.6* | 91.4 | 0.09409191 | ||
| Heart | 11.5 | 32.7 | 55.8 | 0.20609319 | 0.5860215 |
| Hypopharyngeal gland | |||||
| Galea | 92.5* | 7.5 | 12.333333 | ||
| Glossa | 36.7 | 63.3 | 0.57977885 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 19.8 | 33.3 | 56.1 | 0.3529412 | 0.59358287 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MPMTCICSFGEECGPNEVFNTCGSACAPTCAQPKTRICTMQCRIGCQCQEGFLRNGEGAC VLPENC |
 Top
| |