![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328786618 XP_397488.3 PREDICTED: hypothetical protein LOC408280 |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 8.5 | 73.3* | 18.1 | 0.46961325 | 4.0497236 |
| Scape | 17.7 | 49.7 | 32.6 | 0.5429448 | 1.5245398 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 15.2* | 30.2 | 54.6 | 0.2783883 | 0.5531136 |
| Leg, middle | 16.9 | 41 | 42.1 | 0.40142518 | 0.9738717 |
| Leg, rear | 29.4 | 29.4 | 41.2 | 0.71359223 | 0.71359223 |
| Mandibular gland | 10.2 | 89.8 | 0.11358575 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 6* | 94 | 0.06382979 | ||
| Sternite | 11.2 | 28.8 | 60.1 | 0.18635607 | 0.47920132 |
| Tergite | 6.8 | 23.6 | 69.7 | 0.09756098 | 0.33859396 |
| Ventriculus | 1.5* | 98.5 | 0.015228426 | ||
| Thoracic muscle | |||||
| Fat body | 0.8* | 9.7* | 89.5 | 0.008938547 | 0.10837989 |
| Malpighian tubules | 32.2 | 33.6 | 34.2 | 0.94152045 | 0.98245615 |
| Nerve chord | 17.7 | 22.6 | 59.7 | 0.2964824 | 0.37855947 |
| Poison sac | |||||
| Sting | |||||
| Heart | 5.4 | 17.2* | 77.4 | 0.069767445 | 0.22222222 |
| Hypopharyngeal gland | |||||
| Galea | 16 | 68* | 16.1 | 0.99378884 | 4.2236023 |
| Glossa | 27.3 | 59* | 13.7 | 1.9927007 | 4.3065696 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 14.5 | 35.2 | 55.7 | 0.26032317 | 0.63195693 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MDIRMLALVLLVNVVGSLADLRSPLFRPRRNGLREDITDQAGISRTRKRETTASPSVSTL HLYTLIPPPDPTASPAPNESPQDKPGPKARSNSSPKSMARRSTNEPNSSTESNNPKSKGA TQSPEDDPSIDSRPRRPAPKPGGRSSTPRSPKPTTSRTDPEDEGAVTRRPAGAADSGRPK DESEPKARGGKARAKARPADSEENPEPRGGKRTDSEEEPSTRRLSNLREKPKAKPRDSDE EMEEEEEEEEEKSRRPSNEPTRKAKRPKGKPAGSSDQESEEAVDSRARGKPAIGSRFDEP DDDEEEESKGKQRAEKSKSNRFPMDSLQNPQNFQFPPFFVPSFVPGFSSPYTNPYSPNAW AGSNGGSRGYGAGAGAASFASATASAGAPDLTSNYNAYPQGGYPGGYGDTSNMVNAPTPG VYNSGGYGSYGGDVYDPSSFAFPDYNFADFQKQMEENFRQLQAQFQKQQQSLFDATNRIA GDPSSIPGLHSAVSSINLGPEGGYQAGAINPVRPGVESRFGEEVPPPSGNSFGVFSSSSS HTMVGPDGKTISHKSSTTGVNDNGKITFRTIED |
|
| |