| Protein: 48142173 XP_393583.1 PREDICTED: proteasome subunit alpha type-7-1-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 41.1 | 28.4 | 30.4 | 1.3519737 | 0.93421054 |
| Scape | 34.1 | 32.4 | 33.5 | 1.0179105 | 0.96716416 |
| Brain | 56.2 | 43.8 | 1.283105 | ||
| Crop | 31.2 | 33.1 | 35.6 | 0.87640446 | 0.9297753 |
| Eye | 23.5 | 40.5 | 36.1 | 0.6509695 | 1.1218836 |
| Intestine | 30.4 | 42.6 | 27.1 | 1.1217712 | 1.5719557 |
| Leg, front | 34.1 | 35.7 | 30.2 | 1.1291391 | 1.1821193 |
| Leg, middle | 31.9 | 35.6 | 32.5 | 0.9815385 | 1.0953846 |
| Leg, rear | 40.5 | 29.8 | 29.7 | 1.3636364 | 1.003367 |
| Mandibular gland | 51.7 | 48.3 | 1.0703933 | ||
| Rectum | 17.2 | 53.4 | 29.4 | 0.585034 | 1.8163265 |
| Salivary gland, cerebral | 76.9 | 23.1 | 3.3290043 | ||
| Salivary gland, thoracic | 31.3 | 33.9 | 34.8 | 0.89942527 | 0.9741379 |
| Sternite | 26 | 39.7 | 34.4 | 0.75581396 | 1.1540698 |
| Tergite | 19.7 | 47.5 | 32.9 | 0.5987842 | 1.443769 |
| Ventriculus | 51.3 | 17.2 | 31.5 | 1.6285714 | 0.5460318 |
| Thoracic muscle | |||||
| Fat body | 20.2 | 38 | 41.8 | 0.4832536 | 0.90909094 |
| Malpighian tubules | 27.2 | 31.9 | 40.9 | 0.6650367 | 0.7799511 |
| Nerve chord | 28.7 | 30.4 | 40.9 | 0.7017115 | 0.7432763 |
| Poison sac | |||||
| Sting | 54.5 | 45.5 | 1.1978022 | ||
| Heart | 24.6 | 42.8 | 32.6 | 0.75460124 | 1.3128834 |
| Hypopharyngeal gland | 56.2 | 43.8 | 1.283105 | ||
| Galea | 20.6 | 47.4 | 32 | 0.64375 | 1.48125 |
| Glossa | 17.6 | 51.4 | 31.1 | 0.5659164 | 1.6527331 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.4 | 39.9 | 35.1 | 0.9230769 | 1.1367521 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTARYDRAITVFSPDGHLLQVEYAQEAVRKGSSAVGVRGNDVVVLGVEKKSIAKLQEERT VRKICLLDEHVVMAFAGLTADARVLINRAQVECQSHRLTVEDPVTLEYITRYIAGLKQKY TQSNGRRPFGISCLLAGFDYDGVPHLYQTEPSGIYYEWKANATGRNAKTVHEFLQKYYTP EEVATEKGTIKLAIRALLEVVQSGRKNLEIAVMRRGQPLQMLDLDTIGEYVTEIEREKEA EAEKKKQKK |
 Top
| |