![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 66547450 XP_392899.2 PREDICTED: 60 kDa heat shock protein mitochondrial-like |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 23.1 | 40.7 | 36.1 | 0.6398892 | 1.1274239 |
| Scape | 29.1 | 34 | 36.9 | 0.7886179 | 0.9214092 |
| Brain | 30.9 | 35.8 | 33.4 | 0.9251497 | 1.0718563 |
| Crop | 19.8 | 43.2 | 37 | 0.53513515 | 1.1675676 |
| Eye | 52.5 | 23.1 | 24.4 | 2.1516395 | 0.9467213 |
| Intestine | 31.1 | 29.3 | 39.6 | 0.78535354 | 0.739899 |
| Leg, front | 34.2 | 34.8 | 31 | 1.1032258 | 1.1225806 |
| Leg, middle | 30.1 | 39.7 | 30.2 | 0.9966887 | 1.3145696 |
| Leg, rear | 42.5 | 36.1 | 21.4 | 1.9859813 | 1.6869159 |
| Mandibular gland | 36.9 | 32.9 | 30.2 | 1.2218543 | 1.089404 |
| Rectum | 31.3 | 37.4 | 31.3 | 1 | 1.1948882 |
| Salivary gland, cerebral | 75.8 | 16.4 | 7.8 | 9.717949 | 2.102564 |
| Salivary gland, thoracic | 30.5 | 34.4 | 35.1 | 0.8689459 | 0.980057 |
| Sternite | 22.4 | 45.9 | 31.6 | 0.70886075 | 1.4525317 |
| Tergite | 16.5 | 54.1 | 29.4 | 0.56122446 | 1.840136 |
| Ventriculus | 32.2 | 34.7 | 33.1 | 0.9728097 | 1.0483384 |
| Thoracic muscle | 6.3 | 61.3 | 32.5 | 0.19384615 | 1.8861538 |
| Fat body | 20.9 | 39.3 | 39.9 | 0.52380955 | 0.9849624 |
| Malpighian tubules | 37.8 | 27.6 | 34.6 | 1.0924855 | 0.7976879 |
| Nerve chord | 31 | 25 | 44.1 | 0.70294785 | 0.5668934 |
| Poison sac | |||||
| Sting | 58.1 | 41.9 | 1.3866348 | ||
| Heart | 20.1 | 37.8 | 42 | 0.47857141 | 0.9 |
| Hypopharyngeal gland | 71.5 | 28.5 | 2.508772 | ||
| Galea | 20 | 49 | 30.9 | 0.64724916 | 1.5857605 |
| Glossa | 27.9 | 35.7 | 36.4 | 0.76648355 | 0.9807692 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30.6 | 39.1 | 32.8 | 0.93292683 | 1.1920732 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MHRLPTILRSAALRQLQTRSYAKDVRFGAEVRALMLQGVDILADAVAVTMGPKGRNVILE QSWGSPKITKDGVTVAKGVELKDKFQNIGAKLVQDVANNTNEEAGDGTTTATVLARAIAK EGFEKISKGANPVEIRRGVMLAVDKVKDELKALSKPVTTPEEIAQVATISANGDKAIGNL ISDAMKKVGKEGVITVKDGKTLHDELEVIEGMKFDRGYISPYFINSSKGAKVEFQDALLL FSEKKISSVQSIIPALELANSQRKPLVIIAEDIDGEALSTLVVNRLKIGLQVAAVKAPGF GDNRKATLQDMAILTGGIVFGDDANLVKLENVQLCDLGEVGEVVITKDDTLFLKGKGKKS DIDHRADVIRDQIANTTSDYEKEKLQERLARLASGVAVLRVGGSSEVEVNEKKDRVHDAL NATRAAVEEGIVPGGGTALLRCIPALRNLKASNNDQETGIKIVANALRMPCLQIAQNAGV DASLVVAKVSDGNLGYDALNDEYVDMIEKGIIDPTKVVRTALTDAAGVASLLTTAEAVVA ELPKEEPQMPMGGGGMGGMGGMGGMGGMGM |
|
| |