![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328782570 XP_003250165.1 PREDICTED: dipeptidase 1-like |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 80.3* | 19.7 | 4.0761423 | ||
| Scape | 7.4* | 65.4 | 27.1 | 0.27306274 | 2.413284 |
| Brain | 81.8* | 18.2 | 4.4945054 | ||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 18.2 | 59.7 | 22.1 | 0.8235294 | 2.7013574 |
| Leg, middle | 13.9 | 59.9 | 26.3 | 0.5285171 | 2.2775664 |
| Leg, rear | 24.2 | 44.7 | 31.2 | 0.775641 | 1.4326923 |
| Mandibular gland | 7 | 93 | 0.07526882 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | 7.6 | 60.5 | 31.9 | 0.23824452 | 1.8965517 |
| Tergite | 10.3 | 45.3 | 44.3 | 0.23250565 | 1.0225734 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 30.9 | 69.1 | 0.447178 | ||
| Malpighian tubules | 27.5 | 33.9 | 38.6 | 0.71243525 | 0.8782383 |
| Nerve chord | 88.6* | 11.4 | 7.7719297 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 6.3 | 68.2 | 25.5 | 0.24705882 | 2.6745098 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | 57.1 | 42.9 | 1.3310024 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 13.6 | 59.7 | 35.8 | 0.37988827 | 1.6675978 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNFLQNSANSVINKCPAIKTEWFTKEFLCTGKMKYVSFGICGLFVIIFIIGLSLALIIDD YNGSDALDNVPLIDGHNDLPYNLYRLLGNNLDQFDFTKNLSDDKLWGKRVCVSCTTDLPR LRKGKVGAQFWAAYVDCSSQYKDAVSLTLRQIDVIKRLIRKYPNDLQFVTKAEDITDAWS KKKIGSMIGVEGGHSIDSSLAVLRLYYDLGVRYMTLTHMCNTPWADASTVTTGGINNLTD FGRAVVYEMNRLGMLVDLSHVSHNVMREVLAISKAPIIFSHSSVFTLCHNNRNVPDDVLY TVKRNNGIVMVNFYSEFVNCNTSRKATMQDVIDHINYIRNLIGPNHVGIGADYDGVNTMP EGFGRRF |
|
| |