| Protein: 58585202 NP_001011630.1 fatty acid binding protein |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 55.7* | 20.9 | 23.3 | 2.390558 | 0.8969957 |
| Scape | 47.9 | 25 | 27.2 | 1.7610294 | 0.9191176 |
| Brain | 69.6* | 11.1 | 19.3 | 3.6062176 | 0.5751295 |
| Crop | 29.8 | 42.9 | 27.3 | 1.0915751 | 1.5714285 |
| Eye | 53.4 | 18.7 | 27.9 | 1.9139785 | 0.6702509 |
| Intestine | 14.1 | 53.7 | 32.2 | 0.4378882 | 1.6677018 |
| Leg, front | 33.8 | 47.3 | 18.9 | 1.7883598 | 2.5026455 |
| Leg, middle | 38.9 | 41.2 | 19.9 | 1.9547739 | 2.0703518 |
| Leg, rear | 79.1 | 13.2 | 7.8 | 10.141026 | 1.6923077 |
| Mandibular gland | 12.7 | 61.5 | 25.8 | 0.49224806 | 2.3837209 |
| Rectum | 95.5* | 4.5 | 21.222221 | ||
| Salivary gland, cerebral | 99* | 1 | 99 | ||
| Salivary gland, thoracic | 43.1 | 27.9 | 29 | 1.4862069 | 0.962069 |
| Sternite | 23.2 | 62 | 14.8 | 1.5675676 | 4.189189 |
| Tergite | 4.8 | 76.3 | 18.9 | 0.25396827 | 4.037037 |
| Ventriculus | 2.1* | 45 | 53 | 0.039622642 | 0.8490566 |
| Thoracic muscle | |||||
| Fat body | 48.2 | 29.1 | 22.7 | 2.123348 | 1.2819383 |
| Malpighian tubules | 38* | 43.9 | 18.1 | 2.0994475 | 2.4254143 |
| Nerve chord | 50.3* | 28.9 | 20.9 | 2.4066985 | 1.3827751 |
| Poison sac | |||||
| Sting | 54.1 | 45.9 | 1.1786492 | ||
| Heart | 32.2 | 48.2 | 19.6 | 1.6428572 | 2.4591837 |
| Hypopharyngeal gland | 88.3 | 11.7 | 7.5470085 | ||
| Galea | 57.9 | 17 | 25.1 | 2.306773 | 0.67729086 |
| Glossa | 52.4 | 21.8 | 25.7 | 2.0389104 | 0.848249 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 42.2 | 42.3 | 22.5 | 1.8755555 | 1.88 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MPDFLGKRYKLYSSENFDDFMKALGVGIMTRKVGSSVSPVVELTENNGLYTLKTTSPFKN TEIKFKLGEEFEEETVDGRKVKSVCTLDGNKLIQVQKGEKQTTIEREFSSTEMKAIMKVD DIICTRVYKIQD |
 Top
| |