| Protein: 66530010 XP_625095.1 PREDICTED: hydroxysteroid dehydrogenase-like protein 2-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 20.2 | 41.1 | 38.7 | 0.52196383 | 1.0620155 |
| Scape | 3.8* | 63.9 | 32.3 | 0.11764706 | 1.9783282 |
| Brain | 64 | 36 | 1.7777778 | ||
| Crop | 22.2 | 77.8 | 0.28534704 | ||
| Eye | |||||
| Intestine | 17.3 | 41.1 | 41.6 | 0.4158654 | 0.9879808 |
| Leg, front | 74.7 | 25.3 | 2.9525692 | ||
| Leg, middle | 78.8* | 21.2 | 3.7169812 | ||
| Leg, rear | 31.2 | 47.9 | 20.9 | 1.492823 | 2.291866 |
| Mandibular gland | 10.4 | 89.6 | 0.11607143 | ||
| Rectum | 2.6 | 63.1 | 34.2 | 0.07602339 | 1.8450292 |
| Salivary gland, cerebral | 17.9 | 70.5* | 11.7 | 1.5299145 | 6.025641 |
| Salivary gland, thoracic | 11.6 | 65 | 23.4 | 0.4957265 | 2.7777777 |
| Sternite | 67.5 | 32.5 | 2.0769231 | ||
| Tergite | 1.6 | 74.9 | 23.5 | 0.068085104 | 3.187234 |
| Ventriculus | 39.2 | 60.8 | 0.6447368 | ||
| Thoracic muscle | |||||
| Fat body | 10.4 | 56.1 | 33.5 | 0.31044775 | 1.6746268 |
| Malpighian tubules | 20.4 | 36.7 | 42.9 | 0.4755245 | 0.85547787 |
| Nerve chord | 12.4 | 53.5 | 34.1 | 0.36363637 | 1.568915 |
| Poison sac | |||||
| Sting | 38.3 | 61.7 | 0.62074554 | ||
| Heart | 7 | 51.3 | 41.8 | 0.16746412 | 1.2272727 |
| Hypopharyngeal gland | 65.9 | 34.1 | 1.9325513 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 13.5 | 57.6 | 38.9 | 0.3470437 | 1.4807198 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MINTGKLAGRTIFITGASRGIGKSIALKAAKDGANIVIAAKTAEPHPKLPGTIYTTAKEI EEIGGKALPCVVDVRFETNIISAVENAVNKFGGIDIVINNASAIHLIDTLSTEMKKYDLM NNINTRGTFLVSKACLPYLKKSSNPHIVNISPPLNLKPIWFKNHIAYTISKYGMSMCAFG MAEEFKNDGIAINTVWPKTAIATAAFEMLVNESNDYARKPEIMADAVYALICKDSKSITG KFLIDEEILRNEGITDFTDYACNPENKDNLMLDLFIDESSDKINVLNKIFQKDINDVNNK SNEKIAQIFTVIQANLNHELVNKIGAIFQFNVKGNEAGTWFLDLKTGDGVAGKGKPNQSP DATLTMDSENFFAMFSGKLKPASAFLMGKLKISGNLQKAMKLEKLMQNLKSKL |
 Top
| |