| Protein: 145386569 NP_001078815.1 apidermin 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 7.6* | 92.4 | 0.08225108 | ||
| Scape | 5.1* | 7.6* | 87.2 | 0.058486238 | 0.08715596 |
| Brain | |||||
| Crop | |||||
| Eye | 19 | 3* | 78 | 0.24358974 | 0.038461536 |
| Intestine | |||||
| Leg, front | 9.7* | 0.8* | 89.5 | 0.10837989 | 0.008938547 |
| Leg, middle | 7.8* | 0.6* | 91.6 | 0.085152835 | 0.006550218 |
| Leg, rear | 9.6* | 1.3* | 89.1 | 0.10774411 | 0.014590348 |
| Mandibular gland | 67.5 | 0.6* | 31.9 | 2.1159875 | 0.018808777 |
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | 4.5* | 9.9* | 85.6 | 0.052570093 | 0.11565421 |
| Tergite | 1.9 | 1.1* | 97 | 0.019587629 | 0.011340206 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 1.3* | 98.7 | 0.013171226 | ||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | 5.7* | 1.2* | 93.1 | 0.06122449 | 0.012889366 |
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 14.5 | 3.2 | 84.9 | 0.17078917 | 0.037691403 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKSLLILFAIVAVVAAFPELERERRGVIAAPALAAVPLAPTIALAAPKVAPAIALAPAPK LLAAPAVVAAPGPWKAW |
 Top
| |