| Protein: 66512822 XP_623369.1 PREDICTED: guanine nucleotide-binding protein G(q) subunit alpha-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 42.9 | 57.1 | 0.7513135 | ||
| Scape | 48.5 | 19.6 | 31.9 | 1.5203762 | 0.61442006 |
| Brain | 34.9 | 65.1 | 0.5360983 | ||
| Crop | 52.3 | 27.8 | 19.9 | 2.6281407 | 1.3969849 |
| Eye | 29.5 | 24 | 46.6 | 0.6330472 | 0.51502144 |
| Intestine | 30.5 | 31.1 | 38.4 | 0.7942708 | 0.8098958 |
| Leg, front | 36.9 | 32.1 | 31 | 1.1903226 | 1.0354838 |
| Leg, middle | 29.2 | 46.6 | 24.1 | 1.2116183 | 1.93361 |
| Leg, rear | 46 | 30.8 | 23.2 | 1.9827586 | 1.3275862 |
| Mandibular gland | |||||
| Rectum | 30.3 | 40.4 | 29.3 | 1.0341297 | 1.3788396 |
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 43.1 | 24.2 | 32.8 | 1.3140244 | 0.7378049 |
| Sternite | 11.4 | 21.8 | 66.8 | 0.17065868 | 0.3263473 |
| Tergite | |||||
| Ventriculus | 37.9 | 62.1 | 0.61030596 | ||
| Thoracic muscle | |||||
| Fat body | 28.4 | 26.7 | 44.9 | 0.6325167 | 0.5946548 |
| Malpighian tubules | 25.9 | 42.1 | 32 | 0.809375 | 1.315625 |
| Nerve chord | 14.4 | 57.7 | 27.9 | 0.516129 | 2.0681005 |
| Poison sac | |||||
| Sting | 60.7 | 39.3 | 1.5445293 | ||
| Heart | 5.6 | 56.3 | 38.1 | 0.14698163 | 1.4776903 |
| Hypopharyngeal gland | 57.6 | 42.4 | 1.3584906 | ||
| Galea | 59.7 | 40.3 | 1.4813895 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.7 | 37.3 | 39.7 | 0.8488665 | 0.9395466 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MACCLSEEAREQKRINQEIERQLRKDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG YSDDDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYTESSNIEKAELVRSVDFETVTTFES PYVEAIKDLWADGGIQECYDRRREYQLTDSAKYYLLEIDRVAAPDYLPTEQDILRVRVPT TGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESENEN RMEESKALFKTIITYPWFQQSSVILFLNKKDLLEEKIMYSHLVDYFPEYNGPQRDAIPAR EFILQMFVDLNPDIEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV |
 Top
| |