| Protein: 288872185 NP_001165874.1 cytochrome c oxidase subunit VIb polypeptide 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 58 | 42 | 1.3809524 | ||
| Scape | 39.6 | 16.4 | 43.9 | 0.90205014 | 0.3735763 |
| Brain | 45 | 55 | 0.8181818 | ||
| Crop | 28.7 | 38.2 | 33.2 | 0.86445785 | 1.1506025 |
| Eye | 66.1 | 14 | 19.9 | 3.321608 | 0.7035176 |
| Intestine | 2.9* | 45.1 | 52.1 | 0.05566219 | 0.86564296 |
| Leg, front | 40.9 | 20.4 | 38.8 | 1.0541238 | 0.52577317 |
| Leg, middle | 30.8 | 40.8 | 28.4 | 1.084507 | 1.4366198 |
| Leg, rear | 20.6 | 43.6 | 35.8 | 0.575419 | 1.2178771 |
| Mandibular gland | 12.5 | 31.2 | 56.3 | 0.22202487 | 0.55417407 |
| Rectum | |||||
| Salivary gland, cerebral | 29.6 | 44 | 26.4 | 1.1212121 | 1.6666666 |
| Salivary gland, thoracic | 36.3 | 40.3 | 23.4 | 1.551282 | 1.7222222 |
| Sternite | 29.6 | 28 | 42.4 | 0.6981132 | 0.6603774 |
| Tergite | 35.3 | 22.5 | 42.2 | 0.8364929 | 0.53317535 |
| Ventriculus | |||||
| Thoracic muscle | 18.8 | 67 | 14.3 | 1.3146853 | 4.6853147 |
| Fat body | 26 | 60.5* | 13.4 | 1.9402986 | 4.5149255 |
| Malpighian tubules | 44.8 | 23.4 | 31.8 | 1.408805 | 0.7358491 |
| Nerve chord | 48.4 | 17.2 | 34.4 | 1.4069767 | 0.5 |
| Poison sac | |||||
| Sting | 22 | 78 | 0.2820513 | ||
| Heart | 54.6 | 16 | 29.5 | 1.8508475 | 0.5423729 |
| Hypopharyngeal gland | 88.6 | 11.4 | 7.7719297 | ||
| Galea | 40.5 | 26.5 | 33 | 1.2272727 | 0.8030303 |
| Glossa | 45.9 | 19.3 | 34.9 | 1.3151863 | 0.5530086 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.3 | 36 | 35.7 | 0.9607843 | 1.0084034 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVKYTELGNATSITPSIELKPNTAPYDPRFPNQNQTRYCYTSFLDFHRCKKRHSEDYEAC QYFKKVYNAMCPNAWIEKWNEQIENGVFPGNI |
 Top
| |