| Protein: 328778192 XP_001119828.2 PREDICTED: 60S ribosomal protein L19 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 37.5 | 39 | 23.5 | 1.5957447 | 1.6595745 |
| Brain | |||||
| Crop | 55.7 | 44.3 | 1.2573364 | ||
| Eye | 4.7 | 57.6 | 37.8 | 0.12433863 | 1.5238096 |
| Intestine | 58.8 | 41.2 | 1.4271845 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 88.2 | 11.8 | 7.4745765 | ||
| Salivary gland, thoracic | 35.8 | 16.6 | 47.6 | 0.7521008 | 0.3487395 |
| Sternite | 33.4 | 50.1 | 16.5 | 2.0242424 | 3.0363636 |
| Tergite | 74.8 | 25.2 | 2.9682539 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 27.4 | 35.3 | 37.3 | 0.73458445 | 0.9463807 |
| Malpighian tubules | 34.4 | 30.7 | 34.9 | 0.98567337 | 0.87965614 |
| Nerve chord | 42.1 | 16.5 | 41.4 | 1.0169082 | 0.39855072 |
| Poison sac | |||||
| Sting | 54.3 | 45.7 | 1.1881838 | ||
| Heart | 18 | 55.8 | 26.2 | 0.6870229 | 2.129771 |
| Hypopharyngeal gland | 9.9 | 90.1 | 0.10987791 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 39.6 | 40 | 37.4 | 1.0588236 | 1.0695187 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQSIRKLIKDGLIIKKPVAVHSR ARVRKNTEARRKGRHCGFGKRKGTANARTPQKDLWIQRMRVLRRLLKKYRETKKIDRHLY HSLYMKAKDQAEARRTKVREARKRRAERIATKKQELLQSYQREDEAAAAQKK |
 Top
| |