| Protein: 66525598 XP_396009.2 PREDICTED: transmembrane emp24 domain-containing protein eca-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 53 | 47 | 1.1276596 | ||
| Scape | 36.2 | 35.5 | 28.3 | 1.2791519 | 1.254417 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | 74.6 | 25.4 | 2.937008 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 30.7 | 34.6 | 34.6 | 0.88728327 | 1 |
| Sternite | 5.9 | 48.1 | 46.1 | 0.12798265 | 1.043384 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 22.8 | 46 | 31.3 | 0.7284345 | 1.4696486 |
| Malpighian tubules | 36.7 | 25.4 | 37.8 | 0.97089946 | 0.6719577 |
| Nerve chord | 71.3 | 28.7 | 2.4843206 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 74.1* | 25.9 | 2.8610039 | ||
| Hypopharyngeal gland | 22.6 | 77.4 | 0.29198965 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 41.4 | 40.9 | 38.3 | 1.0809399 | 1.0678852 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLKYGIFLVLLCILEYGTGLYFHIAETERKCFMEDIPDETTVLVNYKVELYDPRTGGFAP SSPGMGMHVQVRDPDDKTILSRVYSSEGRFSFTSFMPGEHIICLYSNTSSWFSGAQLRVH LDIQVGEHAIDYSNTAHKEKFTELQLRIHQLLDQVEQITKEQNYQRYREERFRQTSESTH RRVFWWSLIQTVIVLIMGTWQMRHLKSFFEAKKLV |
 Top
| |