| Protein: 66510566 XP_395664.2 PREDICTED: flexible cuticle protein 12 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 77.8* | 22.2 | 3.5045044 | ||
| Scape | 54.7 | 22.8 | 22.5 | 2.431111 | 1.0133333 |
| Brain | |||||
| Crop | 66.8 | 7.2 | 26 | 2.5692308 | 0.2769231 |
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 53.5 | 46.5 | 1.1505376 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | 23.6 | 31.9 | 44.5 | 0.5303371 | 0.7168539 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | 0.7 | 99.3 | 0.007049345 | ||
| Sting | 74* | 26 | 2.8461537 | ||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | 24.4 | 45.6 | 30 | 0.81333333 | 1.52 |
| Glossa | 37 | 41.1 | 21.9 | 1.6894977 | 1.8767123 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 43.3 | 37.6 | 37.7 | 1.1485411 | 0.9973475 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MHRGSLVSRITRRLRTKGQKSNSHEEVFAMKTILIFVTVIVGAFAAPQVNPNEITIIKQE EQNNIGVGGYHFSYEQSDGQKREETAELKNEGTDDESLDVTGSFSFTSPDGHTYRVDYTA DKDGFHPTINLVSK |
 Top
| |