| Protein: 66506619 XP_393283.2 PREDICTED: uncharacterized peptidase C1-like protein F26E4.3-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 62 | 38 | 1.6315789 | ||
| Brain | |||||
| Crop | 28.9 | 71.1 | 0.40646976 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 6.3 | 93.7 | 0.06723586 | ||
| Rectum | |||||
| Salivary gland, cerebral | 7.3 | 21.8 | 70.9 | 0.10296192 | 0.30747533 |
| Salivary gland, thoracic | 4.2* | 65.6 | 30.2 | 0.13907285 | 2.1721854 |
| Sternite | 39 | 61 | 0.6393443 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 84.7 | 8 | 7.4 | 11.445946 | 1.081081 |
| Malpighian tubules | 3.5 | 92.6* | 3.9 | 0.8974359 | 23.74359 |
| Nerve chord | 97.8* | 0.8 | 1.4 | 69.85714 | 0.5714286 |
| Poison sac | |||||
| Sting | 47.4 | 52.6 | 0.9011407 | ||
| Heart | 28.1 | 39.5 | 32.4 | 0.86728394 | 1.2191358 |
| Hypopharyngeal gland | |||||
| Galea | 36.2 | 32.7 | 31.1 | 1.1639872 | 1.0514469 |
| Glossa | 43.2 | 26.7 | 30.2 | 1.4304636 | 0.884106 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 37.3 | 36.6 | 40.3 | 0.9255583 | 0.9081886 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MRSWENLACGIFLVVVTIVNGMPDYTGLPSGPYCARRYPGCCPDRQDDCNAPILDSICYC DEFCNRFREEDCCPDYWSHCKGINMTEPPPEPIKRCYHQGRYYNDGQVFKLNCNTCKCTA VSRLAEVLCEQNRCLQEQSLIDEVNSISSLNWRARNYSEFWGKRLSEGVKLRLGTLNPSN SVYRMNSVRRVYDPESLPREFDARTRWRRQISGVDDQGWCGASWAISTAQVASDRFAVMS KGTDSVLLSAQHLLSCNKKGQRGCDGGYLDRAWLFMRKFGLVDEQCYPWKGVYEQCKLQK RTNLEAAGCRAPANPLRKELYKVGPAYRLGNETDIMREILTSGPVQATMKVYQDFFSYES GIYMHTPIAELYESGYHSVRIIGWGEDISTDSGLPIKYWLVVNSWGQEWGENGLFRIRRG INECDIESFVVAVWAKTNV |
 Top
| |