| Protein: 66550553 XP_395159.2 PREDICTED: phosphotriesterase-related protein-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 53.8 | 20.1 | 26.1 | 2.0613027 | 0.77011496 |
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | 76* | 24 | 3.1666667 | ||
| Leg, rear | 91* | 9 | 10.111111 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 51.1 | 18.1 | 30.9 | 1.6537217 | 0.58576053 |
| Sternite | 22.4 | 51 | 26.6 | 0.84210527 | 1.9172932 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 23.2 | 37.5 | 39.3 | 0.5903308 | 0.9541985 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 52.9 | 31.7 | 26 | 2.0346153 | 1.2192308 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MEHATDYVETVFGKKNANQLGRILTHEHLSMSFIEFYVQPPSHLKQFFDDKKIELQTVGI LKQYPYSSSYNLIYNDQYTEDAVLEDVKLYKKFGGGTIVENSNYGLKRNIPFMKKVSEAT GINVIAGTGYYVSATQTNENLSKEEMYDVILKEMTIGCEESPDVKAGFIGEVGSTWPITA FEKRAIQATAEVQQQLKCPVSFHPGRDSAAPSEIMRIYQEAGGNARKAILSHLDRTILGL EELLEFSDDVKCYCQFDLFGTECSFYQLNPSIDMMSDAQRIERVKYFRDNKKLDRVLLSH DIHTKHKLIKFGGHGFSHILNNVVPKMMLKGFILEEIDMLTIHNPKTWLTS |
 Top
| |