| Protein: 66512193 XP_392437.2 PREDICTED: probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 7 mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 47.5 | 18.7 | 33.8 | 1.4053254 | 0.5532544 |
| Brain | 49.1 | 50.9 | 0.96463656 | ||
| Crop | |||||
| Eye | 40.1 | 59.9 | 0.6694491 | ||
| Intestine | 40.8 | 23.6 | 35.6 | 1.1460674 | 0.66292137 |
| Leg, front | 27.4 | 30.2 | 42.4 | 0.6462264 | 0.7122642 |
| Leg, middle | 58.8 | 41.2 | 1.4271845 | ||
| Leg, rear | 22.8 | 26.2 | 51 | 0.44705883 | 0.5137255 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 27 | 34.9 | 38.2 | 0.7068063 | 0.91361254 |
| Salivary gland, thoracic | 22.6 | 52.1 | 25.3 | 0.8932806 | 2.0592885 |
| Sternite | 31.1 | 30.8 | 38.1 | 0.816273 | 0.80839896 |
| Tergite | 43.8 | 56.2 | 0.77935946 | ||
| Ventriculus | |||||
| Thoracic muscle | 49.5 | 50.5 | 0.980198 | ||
| Fat body | 21.8 | 56.2 | 21.9 | 0.9954338 | 2.56621 |
| Malpighian tubules | 29.2 | 33.5 | 37.3 | 0.7828418 | 0.8981233 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 36.9 | 63.1 | 0.58478606 | ||
| Heart | 36.9 | 23.5 | 39.6 | 0.9318182 | 0.59343433 |
| Hypopharyngeal gland | 97.3 | 2.7 | 36.037037 | ||
| Galea | 50.4 | 10.3 | 39.4 | 1.2791878 | 0.26142132 |
| Glossa | 59 | 11.7 | 29.3 | 2.0136518 | 0.3993174 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38 | 35.7 | 39.8 | 0.95477384 | 0.89698493 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLRSLVFSPSVNQGLTSLIRNNIALAGCPASLVCQTKHMATEISKTSESSLPEKAKKIPY SPFQNTNNLAEYAVARLDDILNWGRKGSIWPLTFGLACCAVEMMHIAAPRYDMDRYGVVF RASPRQADVIIVAGTLTNKMAPALRKIYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGC DRIIPVDIYVPGCPPTAEALMYGILQLQKKIKRMKTLQIWYRQ |
 Top
| |