| Protein: 48095960 XP_392368.1 PREDICTED: cytochrome c oxidase subunit 5A mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 40.1 | 29.3 | 30.6 | 1.3104575 | 0.9575163 |
| Scape | 52 | 21.1 | 26.9 | 1.9330856 | 0.78438663 |
| Brain | 49.1 | 50.9 | 0.96463656 | ||
| Crop | 31.2 | 34.3 | 34.5 | 0.90434784 | 0.9942029 |
| Eye | 45.3 | 22 | 32.7 | 1.3853211 | 0.6727829 |
| Intestine | 33.6 | 27.8 | 38.7 | 0.86821705 | 0.71834624 |
| Leg, front | 28.1 | 32.7 | 39.1 | 0.71867007 | 0.8363171 |
| Leg, middle | 38.9 | 32 | 29.1 | 1.3367697 | 1.0996563 |
| Leg, rear | 25.6 | 22.5 | 52 | 0.4923077 | 0.43269232 |
| Mandibular gland | 34.4 | 19.8 | 45.8 | 0.7510917 | 0.4323144 |
| Rectum | 4 | 72.1 | 23.9 | 0.16736402 | 3.0167365 |
| Salivary gland, cerebral | 35.3 | 31.1 | 33.6 | 1.0505953 | 0.9255952 |
| Salivary gland, thoracic | 17.8 | 56.4 | 25.8 | 0.68992245 | 2.1860466 |
| Sternite | 30.5 | 29.1 | 40.4 | 0.7549505 | 0.72029704 |
| Tergite | 27.6 | 26.5 | 45.9 | 0.6013072 | 0.57734203 |
| Ventriculus | |||||
| Thoracic muscle | 12.2 | 74.9 | 12.9 | 0.9457364 | 5.8062015 |
| Fat body | 21.5 | 55.6 | 22.9 | 0.93886465 | 2.4279475 |
| Malpighian tubules | 40.9 | 26.3 | 32.8 | 1.2469512 | 0.8018293 |
| Nerve chord | 51.3 | 13.6 | 35.1 | 1.4615384 | 0.38746437 |
| Poison sac | |||||
| Sting | 19.5 | 80.5 | 0.24223602 | ||
| Heart | 43.3 | 23 | 33.6 | 1.2886904 | 0.6845238 |
| Hypopharyngeal gland | 90.2 | 9.8 | 9.204082 | ||
| Galea | 40.3 | 31.1 | 28.5 | 1.4140351 | 1.0912281 |
| Glossa | 38.2 | 23.4 | 38.4 | 0.9947917 | 0.609375 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33 | 36 | 35.2 | 0.9375 | 1.0227273 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLRFVGKQINNTLRNSLIPYNTVIRQNIRASHDGPQETEEEFNKQYVTYLNRTNLDHWEF RQAMNKLAAMDLVPDPSIICAALRACRRLNDFALAIRVLEMIKDKCGSKVKEIYPYILQE IKPTLDELGINTIEELGYDKPELALQSIDDIH |
 Top
| |