![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328785297 XP_623191.2 PREDICTED: protein ERGIC-53-like isoform 1 |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 41.6 | 22.3 | 36.1 | 1.1523546 | 0.61772853 |
| Scape | 54.6 | 16.6 | 28.8 | 1.8958334 | 0.5763889 |
| Brain | |||||
| Crop | 42.7 | 57.3 | 0.7452007 | ||
| Eye | |||||
| Intestine | 59.7 | 40.3 | 1.4813895 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 79.6 | 20.4 | 3.9019608 | ||
| Salivary gland, thoracic | 30.3 | 36.2 | 33.5 | 0.9044776 | 1.080597 |
| Sternite | 29.8 | 32.4 | 37.8 | 0.78835976 | 0.85714287 |
| Tergite | 69.8 | 30.2 | 2.3112583 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 36.9 | 27.1 | 36 | 1.025 | 0.75277776 |
| Malpighian tubules | |||||
| Nerve chord | 47 | 23.8 | 29.2 | 1.6095891 | 0.8150685 |
| Poison sac | 83.2 | 16.8 | 4.952381 | ||
| Sting | |||||
| Heart | 6.1 | 55.3 | 38.6 | 0.15803109 | 1.4326425 |
| Hypopharyngeal gland | 14.5 | 85.5 | 0.16959064 | ||
| Galea | 31.1 | 19.9 | 49.1 | 0.6334012 | 0.4052953 |
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 39.7 | 38.7 | 38.5 | 1.0311688 | 1.0051948 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKMAAEVRWLLIFHVFSVIYTVFGEIPHRKFEYKYSFKPPYLAQKDGSVPFWEYGGNAIA SAENVRVAPSLRSQKGAIWVKHPVTSFEWWEVELIFRITGRGRIGADGLAFWYTGEKGAY NGTVFGSSDQWHGLGIFFDSFDNDNKHNNPYIMAVLNDGKKTFDHANDGTTQLCAGCLRD FRNKPFATRAKIEYYKNTLTLLFHNGMTNNEQDYETCFQVEDVFLPKGGFFGVSAATGGL ADDHDVSHFLTHSLYPPGQLRPDQKVSLEEQQKLSQEYMDYQKKLEQRKEEYRRDHPDEH REKEEFEEYFETDNQRELRQIFSGQSQMFDALRELNRKLDNIVGTQERSLSLISQIQVGG VQVGGQPGQQVQLIDTIRRQEVDTLLNNQNNILNTAREIKSYVNEVYSKADTILSNQARA PTAQVQQMGYDYHSLISEMRDGLNTLKRDITQLSTKINSGGTDCPTTNCLTTTMFLLFVA IQMIILLAYSTYRDNKEAQAKKLY |
|
| |