![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328785742 XP_395065.3 PREDICTED: clathrin light chain |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 24.5 | 53.7 | 21.8 | 1.1238532 | 2.4633029 |
| Sternite | 53 | 47 | 1.1276596 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 79.3 | 20.7 | 3.8309178 | ||
| Malpighian tubules | 62.1 | 37.9 | 1.6385224 | ||
| Nerve chord | 25.6 | 9 | 65.4 | 0.39143732 | 0.13761468 |
| Poison sac | |||||
| Sting | |||||
| Heart | 21.3 | 41.5 | 37.2 | 0.57258064 | 1.1155914 |
| Hypopharyngeal gland | 13.3 | 86.7 | 0.15340254 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.4 | 41.6 | 45.2 | 0.73893803 | 0.920354 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MDAFGDNFVNEEVDPVAEFVAREQDQLAGLENEIPSVSMSAPVTAPNTDVGPGGDAEGSF EIIDAIGQLPETQASSIIETVSKPLPVKEEPEKIRKWREEQKARLEEKDAEEEKKKEEWR EAARKELEEWYKHHAEAISKTKTTNRESAKNAEKQFVAEADEVEPGTEWERIAKLCDFNP KSSRTSKDVSRMRSIILQLKQTPPAPVSL |
|
| |