| Protein: 48104864 XP_392983.1 PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 48.3 | 51.7 | 0.934236 | ||
| Scape | 50.2 | 17.8 | 32.1 | 1.5638629 | 0.55451715 |
| Brain | |||||
| Crop | 52.5 | 47.5 | 1.1052631 | ||
| Eye | 15.5* | 84.5 | 0.18343195 | ||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 16.5 | 83.5 | 0.19760479 | ||
| Rectum | |||||
| Salivary gland, cerebral | 29.4 | 30.5 | 40.1 | 0.73316705 | 0.7605985 |
| Salivary gland, thoracic | 30.8 | 46.4 | 22.8 | 1.3508772 | 2.0350878 |
| Sternite | 62.7 | 2.2* | 35.1 | 1.7863247 | 0.06267806 |
| Tergite | 48.4 | 51.6 | 0.93798447 | ||
| Ventriculus | |||||
| Thoracic muscle | 12.7 | 73.2 | 14.1 | 0.9007092 | 5.191489 |
| Fat body | 17.6 | 50.1 | 32.3 | 0.54489166 | 1.5510836 |
| Malpighian tubules | 37.6 | 22.8 | 39.6 | 0.94949496 | 0.57575756 |
| Nerve chord | 43.6 | 15.7 | 40.7 | 1.0712531 | 0.3857494 |
| Poison sac | |||||
| Sting | 35.4 | 64.6 | 0.54798764 | ||
| Heart | 53 | 18.9 | 28.2 | 1.8794327 | 0.67021275 |
| Hypopharyngeal gland | 89.5 | 10.5 | 8.523809 | ||
| Galea | 94.4* | 5.6 | 16.857143 | ||
| Glossa | 75.2* | 3.7* | 21.1 | 3.563981 | 0.17535545 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 39.8 | 38.6 | 39.2 | 1.0153061 | 0.9846939 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVVTKNFQLPSDEELNTQEINISWPYIHAAAVFLGKRCEWFNNEFMLCRYELKDPRKCLK EGKDVTKCALEGLQDIKKHCRNEFEAHVNCVIETSATGSNDQHCRKTRKIFDDCMKKNLN LERPSFGYFCEAKVHDSPRPKPSKEKTEYPDRVPEPVAPPYPPSKYQGRQGFNI |
 Top
| |