| Protein: 296010815 NP_001171538.1 ubiquinone biosynthesis protein COQ7 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 6.4* | 28.3 | 65.3 | 0.09800919 | 0.4333844 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 49.5 | 14 | 36.5 | 1.3561643 | 0.38356164 |
| Sternite | 10.3 | 50.5 | 39.2 | 0.2627551 | 1.2882653 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | 58.3 | 41.7 | 1.3980815 | ||
| Glossa | 57.8 | 42.2 | 1.3696682 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 22.1 | 41.8 | 45 | 0.4911111 | 0.9288889 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLHLRQYGIRLASTSAISGTTKPGKLLDSIIRVDHAGELGADRIYAGQMAVLGRTSVGPT IQHMWDQEKKHRAKFEELITKYRVRPTVLIPIWNVAGFILGAGTALMGEKAAMACTVAVE TVITEHYNDQLRALVENEEKVDEEILETIKKFRDEEQEHHDTGIEYGAEQAPFYQALTNI IKFGCKTAISISKVI |
 Top
| |