| Protein: 328777788 XP_393544.3 PREDICTED: myosin light chain alkali-like isoform 4 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 62.5 | 37.5 | 1.6666666 | ||
| Scape | 40.4 | 37.3 | 22.2 | 1.8198198 | 1.6801802 |
| Brain | |||||
| Crop | 40.7 | 8 | 51.4 | 0.7918288 | 0.15564202 |
| Eye | |||||
| Intestine | 11.8 | 30.6 | 57.6 | 0.2048611 | 0.53125 |
| Leg, front | 38.8 | 35.9 | 25.4 | 1.527559 | 1.4133859 |
| Leg, middle | 43.3 | 29.5 | 27.2 | 1.5919118 | 1.0845588 |
| Leg, rear | 26.7 | 41.7 | 31.6 | 0.8449367 | 1.3196203 |
| Mandibular gland | 59 | 0.4* | 40.6 | 1.453202 | 0.009852217 |
| Rectum | 0.9 | 81 | 18.1 | 0.049723756 | 4.475138 |
| Salivary gland, cerebral | 2.5* | 52 | 45.5 | 0.054945055 | 1.1428572 |
| Salivary gland, thoracic | 79.8* | 6.9 | 13.3 | 6 | 0.518797 |
| Sternite | 54.1 | 17.7 | 28.2 | 1.9184397 | 0.62765956 |
| Tergite | 60.6 | 9.3 | 30.1 | 2.013289 | 0.3089701 |
| Ventriculus | |||||
| Thoracic muscle | 1.1 | 97.7* | 1.2 | 0.9166667 | 81.416664 |
| Fat body | 88.6* | 9.2* | 2.2 | 40.272728 | 4.181818 |
| Malpighian tubules | 43.5 | 6.9* | 49.6 | 0.8770161 | 0.1391129 |
| Nerve chord | 50 | 12.6 | 37.4 | 1.3368984 | 0.3368984 |
| Poison sac | 38.7 | 61.3 | 0.6313214 | ||
| Sting | 31 | 69 | 0.44927537 | ||
| Heart | 20.6 | 48.8 | 30.6 | 0.67320263 | 1.5947713 |
| Hypopharyngeal gland | 99.5* | 0.5 | 199 | ||
| Galea | 38.1 | 30.3 | 31.7 | 1.2018927 | 0.95583594 |
| Glossa | 31 | 28.5 | 40.6 | 0.7635468 | 0.70197046 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.5 | 35.5 | 32.7 | 1.1773701 | 1.085627 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MADLSAKEVEKAEFAFSIYDADGTNVIDAIDLGNVLRALNLNPTNATIEKLGGTKKKGEK LMKLDEFLPIYSQCKKDKDQGCYEDFVECLKLYDKQENGTMLGAELSHTLLALGEKLSDA EVEEVLKDCMDPEDEDGFIPYTPFLKKMMVLL |
 Top
| |