| Protein: 328793743 XP_397073.4 PREDICTED: vanin-like protein 1-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 8.9 | 75.1* | 16.1 | 0.55279505 | 4.664596 |
| Scape | |||||
| Brain | |||||
| Crop | 50.1 | 49.9 | 1.004008 | ||
| Eye | |||||
| Intestine | 57.5 | 7.6* | 34.9 | 1.6475644 | 0.21776505 |
| Leg, front | 29.7 | 24.1 | 46.1 | 0.64425164 | 0.52277654 |
| Leg, middle | 28.2 | 24 | 47.8 | 0.58995813 | 0.50209206 |
| Leg, rear | 59.6 | 18.4 | 22 | 2.709091 | 0.8363636 |
| Mandibular gland | |||||
| Rectum | 56.7 | 3.6 | 39.7 | 1.4282116 | 0.0906801 |
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 26.7 | 39.3 | 34 | 0.7852941 | 1.1558824 |
| Sternite | 61.6 | 38.4 | 1.6041666 | ||
| Tergite | |||||
| Ventriculus | 78.5 | 21.5 | 3.6511629 | ||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 31.9 | 38.2 | 29.9 | 1.0668896 | 1.277592 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 39.2 | 60.8 | 0.6447368 | ||
| Heart | 14.9 | 55.3 | 29.8 | 0.5 | 1.8557047 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.4 | 38.7 | 36.2 | 1.0055249 | 1.0690608 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MRGKLNEFGLLLILVQSSYQVTIQNSTDYYTAAVVEFTPTYVKDNGPLTLSKNTDAYIKY IEKASKQNADIIVFPEDGLTSLHMPNRSHMDSWTTLVPSIHDNYVPCTDTNIDVSETLKR LSCAAKQNRIYVVINIAEKRLNNDECLSNLTWHYHNTNVVFDRMGKIIARYRKVNLYMEK QFDKTKIPEIVTFDTDFGVKFGTFICFDILFSVPALNLTRTLGVSNIIFTTAWFSEVPFL TAVQTQFGWSFAENVNLLAAGYHQPNIGSLGSGIYLGRNGLINATMFNNPKYRLLISQVP KSTKSREIEERQIVQKLRKEKKKRVKKYIIRYETFDFYKSKKGNIFNSIKLLHDNVTSFE SILINKSIIQSICYHNFCCDFEAHIDTINLSSIHYRAVVFDNVRLYGKEVEAGVRLCALI QCSDDSIDSCGFIGQSNTTFSALSITARFNDYPKILVMPSVLNSSLLPFEQWSYIEHTYE KQTNVTIALNEPTKNIVTFGIYVRDFEKDK |
 Top
| |