| Protein: 110756571 XP_001122174.1 PREDICTED: 40S ribosomal protein S16 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 37.6 | 62.4 | 0.6025641 | ||
| Scape | 44.9 | 23.8 | 31.3 | 1.4345047 | 0.76038337 |
| Brain | |||||
| Crop | 17.5 | 43.8 | 38.7 | 0.4521964 | 1.1317829 |
| Eye | 23.7 | 28.9 | 47.4 | 0.5 | 0.6097046 |
| Intestine | 14 | 53.6 | 32.4 | 0.43209878 | 1.654321 |
| Leg, front | 27.6* | 72.4 | 0.38121548 | ||
| Leg, middle | |||||
| Leg, rear | 46.9 | 38.9 | 14.2 | 3.3028169 | 2.7394366 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 81.1 | 18.9 | 4.291005 | ||
| Salivary gland, thoracic | 32.5 | 25.1 | 42.4 | 0.7665094 | 0.5919811 |
| Sternite | 77.7 | 22.3 | 3.484305 | ||
| Tergite | 48.6 | 43.4 | 8 | 6.075 | 5.425 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 35.7 | 32.1 | 32.2 | 1.1086956 | 0.9968944 |
| Malpighian tubules | 42.6 | 20.1 | 37.3 | 1.1420912 | 0.538874 |
| Nerve chord | 46.4 | 8.8 | 44.8 | 1.0357143 | 0.19642857 |
| Poison sac | |||||
| Sting | 51.6 | 48.4 | 1.0661157 | ||
| Heart | 11.7 | 55 | 33.3 | 0.35135135 | 1.6516516 |
| Hypopharyngeal gland | 14.9 | 85.1 | 0.17508814 | ||
| Galea | 32.6 | 67.4 | 0.48367953 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.4 | 36.7 | 41 | 0.88780487 | 0.89512193 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MQKKQKEPIQSVQVFGRKKSATAVAYCKRGRGNLRVNGRPLELVEPRVLQYKLQEPILLL GKEKFSGVDIRVRVNGGGHVAQIYAIRQAISKALVAYYQKYVDEASKKEVKDILIQYDRT LLVADPRRCEPKKFGGPGARARYQKSYR |
 Top
| |