| Protein: 328790007 XP_003251356.1 PREDICTED: ribonuclease Oy |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 53.9 | 46.1 | 1.1691974 | ||
| Scape | |||||
| Brain | 35.5 | 64.5 | 0.5503876 | ||
| Crop | 22.7 | 55.8* | 21.5 | 1.0558139 | 2.5953488 |
| Eye | |||||
| Intestine | 21 | 58.1* | 20.9 | 1.0047847 | 2.7799044 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 8.2 | 91.8 | 0.089324616 | ||
| Rectum | 91.6* | 8.4 | 10.904762 | ||
| Salivary gland, cerebral | 56.4 | 43.6 | 1.293578 | ||
| Salivary gland, thoracic | 18.1 | 53 | 28.9 | 0.6262976 | 1.83391 |
| Sternite | 16.1 | 83.9 | 0.19189511 | ||
| Tergite | |||||
| Ventriculus | 24.8 | 75.2 | 0.32978722 | ||
| Thoracic muscle | |||||
| Fat body | 46.1 | 17.7 | 36.2 | 1.2734807 | 0.48895028 |
| Malpighian tubules | 20.5 | 37.7 | 41.7 | 0.4916067 | 0.90407676 |
| Nerve chord | 59.9 | 40.1 | 1.4937656 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 6.4 | 51.8 | 41.8 | 0.15311004 | 1.2392344 |
| Hypopharyngeal gland | 11.8 | 88.2 | 0.13378684 | ||
| Galea | 40.2 | 59.8 | 0.6722408 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.8 | 40.6 | 49.5 | 0.66262627 | 0.820202 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLNWKKFAIILFLFFIGKVNSKSWNRIPRSNNDFDALIFTQHWPQTVCYTWKEKSTSNTC SLPKEHNEWTIHGIWPSQYHKIGPEFCNDKLPFNSTALESLKEKLQEKWIDIEKGKTSYS LWQHEWDKHGTCAVELEQLNTEIKYFTKGLELLSIYDMKNILAKANIIPGQTYNKTEILN AIEQQLNKRGILICQENKENHIYLRYEYVLIKH |
 Top
| |