| Protein: 328794201 XP_003252017.1 PREDICTED: apolipoprotein D-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 48.1 | 51.9 | 0.92678225 | ||
| Scape | 52.7* | 33.8 | 13.5 | 3.9037037 | 2.5037036 |
| Brain | 38.8 | 61.2 | 0.63398695 | ||
| Crop | 50.7 | 12.7 | 36.7 | 1.3814714 | 0.34604904 |
| Eye | |||||
| Intestine | 20.6* | 79.4 | 0.25944585 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 23.5 | 76.5 | 0.30718955 | ||
| Rectum | |||||
| Salivary gland, cerebral | 1 | 95.6* | 3.4 | 0.29411766 | 28.117647 |
| Salivary gland, thoracic | 53.7 | 19.3 | 26.9 | 1.9962826 | 0.71747214 |
| Sternite | 10.9 | 34.5 | 54.6 | 0.1996337 | 0.6318681 |
| Tergite | 20.1 | 79.9 | 0.25156444 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 17.7 | 8.4* | 73.8 | 0.2398374 | 0.11382114 |
| Malpighian tubules | 54.3 | 12.4 | 33.3 | 1.6306306 | 0.37237236 |
| Nerve chord | 38 | 31.2 | 30.8 | 1.2337662 | 1.012987 |
| Poison sac | |||||
| Sting | |||||
| Heart | 33.3 | 18.9 | 47.9 | 0.69519836 | 0.39457202 |
| Hypopharyngeal gland | |||||
| Galea | 27.7 | 59.8* | 12.5 | 2.216 | 4.784 |
| Glossa | 73.7* | 9.6 | 16.8 | 4.3869047 | 0.5714286 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.1 | 30.4 | 43.7 | 0.82608694 | 0.6956522 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNSTFYLTFLLGCFVLVKTHTYHVGPCPIVEPMQGFQINKFLGIWYVIQKTSTASKCITY NYTRGEEPGEYILKQDSDHPVLSLTSLKNEYHYTGELTIPNPSTPALMKVRFPLSVAGSA SHVVFATDYNNYAGVFTCQKLTFAHRQSATILSRNRELDKTSIDNLRQKLSDFGVNPFDL SIISQTKCSHGNNSLDITVDPSTFTSQNIGNLVRKAGEKVGDGVEWVANMGSKVYHKLTG SEEKITSKPQETTEKNLMRHYEETNEVEWIP |
 Top
| |