| Protein: 66543659 XP_394854.2 PREDICTED: 60S ribosomal protein L30 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 42 | 19 | 39 | 1.0769231 | 0.4871795 |
| Brain | |||||
| Crop | 3.6* | 51.4 | 45 | 0.08 | 1.1422222 |
| Eye | |||||
| Intestine | 58.4 | 41.6 | 1.4038461 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 72.5 | 7 | 20.4 | 3.5539215 | 0.34313726 |
| Salivary gland, thoracic | 38.4 | 22.1 | 39.5 | 0.9721519 | 0.55949366 |
| Sternite | 33.2 | 50.4 | 16.4 | 2.0243902 | 3.0731707 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 28.3 | 38.5 | 33.3 | 0.8498499 | 1.1561562 |
| Malpighian tubules | 36.8 | 22.3 | 40.9 | 0.8997555 | 0.5452323 |
| Nerve chord | 55.7 | 8.5 | 35.8 | 1.5558659 | 0.23743017 |
| Poison sac | |||||
| Sting | |||||
| Heart | 16.6 | 50.1 | 33.3 | 0.4984985 | 1.5045046 |
| Hypopharyngeal gland | 12.3 | 87.7 | 0.14025086 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.3 | 30.9 | 39.4 | 0.9213198 | 0.78426397 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVAQKKQKKSQEGINSRLALVMKSGKYVLGYKQTLKSLRQGKAKLVIIANNAAPLRKSEI EYYAMLAKTGVHHYIGNNIELGTACGKYFRVCTLSITDPGNSDIIKSMPTGEQP |
 Top
| |