| Protein: 66551967 XP_624896.1 PREDICTED: 60S ribosomal protein L13 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 39.7 | 60.3 | 0.6583748 | ||
| Scape | 40 | 31.1 | 28.9 | 1.384083 | 1.0761245 |
| Brain | |||||
| Crop | 33.3 | 27.2 | 39.5 | 0.84303796 | 0.6886076 |
| Eye | 0.9* | 48.2 | 50.9 | 0.017681729 | 0.9469548 |
| Intestine | 13.3 | 49.2 | 37.4 | 0.35561496 | 1.315508 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | 47.4 | 40.6* | 12 | 3.95 | 3.3833334 |
| Mandibular gland | |||||
| Rectum | 82.4 | 17.6 | 4.681818 | ||
| Salivary gland, cerebral | 85.3 | 0.3* | 14.4 | 5.923611 | 0.020833332 |
| Salivary gland, thoracic | 31.4 | 29.2 | 39.3 | 0.7989822 | 0.74300253 |
| Sternite | 30.1 | 53.7 | 16.2 | 1.8580247 | 3.3148148 |
| Tergite | 43 | 51.4* | 5.6 | 7.678571 | 9.178572 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 29 | 33.2 | 37.8 | 0.76719576 | 0.87830687 |
| Malpighian tubules | 33.1 | 26.9 | 40 | 0.8275 | 0.6725 |
| Nerve chord | 54.4 | 14 | 31.6 | 1.721519 | 0.443038 |
| Poison sac | |||||
| Sting | 49.5 | 50.5 | 0.980198 | ||
| Heart | 19.3 | 53.1 | 27.5 | 0.70181817 | 1.930909 |
| Hypopharyngeal gland | 19.7 | 80.3 | 0.24533 | ||
| Galea | 50.6 | 18.7 | 30.7 | 1.6482085 | 0.60912055 |
| Glossa | 30.9 | 8.6* | 60.5 | 0.5107438 | 0.14214876 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.1 | 35.6 | 35.8 | 1.0083799 | 0.99441344 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGKRNNMIPNGHFHKDWQRFVKTWFNQPARKYRRKQNRVKKARTVAPRPVKLLRPVVHCP TFRYHTKVRAGKGFTLEELKASGLNKRFARTIGIAVDPRRRNKSVESLQTNAQRLKEYKS KLILFPLNEKKPKKGDASEEEMKLATQVKGEIMPVRHQAPAKAKARVISEEERKFSAYVT LRKARADARLVGIRAKRVKDAAENPDDVTKVGKDKKAKK |
 Top
| |