![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 110760453 XP_396885.3 PREDICTED: dnaJ homolog subfamily C member 3 |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 36 | 64 | 0.5625 | ||
| Brain | |||||
| Crop | 55.2 | 44.8 | 1.2321428 | ||
| Eye | |||||
| Intestine | 37.1 | 62.9 | 0.5898251 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 76.7 | 23.3 | 3.2918456 | ||
| Salivary gland, thoracic | 44.7 | 19.3 | 35.9 | 1.2451253 | 0.53760445 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 35.9 | 45 | 19 | 1.8894737 | 2.368421 |
| Malpighian tubules | 34.2 | 26.8 | 39 | 0.8769231 | 0.6871795 |
| Nerve chord | 63.2 | 36.8 | 1.7173913 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 16.6 | 57.1 | 26.3 | 0.63117874 | 2.1711028 |
| Hypopharyngeal gland | 48 | 52 | 0.9230769 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 45.3 | 38.9 | 40.4 | 1.1212871 | 0.9628713 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MYHCGLLLVLLDLSLDVVGSVSQLEIDRHLELGREFLAKGQLQDALSHYHAAVEGDPNNY LTYYKRGTVYLALGKAKFALLDLDRVLELKPDFTSARLQRGNVLLKQAQFEKAEADFRDV LAIEPQNSDAYNALYKIAPAQEDLLVVDRLKMNGDYTAAMHQITRVIEICPWSAELRQRR AELYEILEDYISAISDVRSTTKLQSDNTQGFLKLATLHYRLGQVEESLKEIRECLKLDPE HSKCFSFYKKVKKVAKLLMSATEYEDKRDYTNCIDSALPILKLEPQVINVRFLAHQLLCK CYTSNQEPTQAIKNCHEALKVRKEAAVYCDRAEAYLAAEMFDDAIRDFKEALEIDMSLQR AKQGLHKAQQRQKLSESRDYYKILGVPRTASKRDIIKAYRKAAQKWHPDNFQEGEEKKLA EKRFIDIAAAKEVLTDDEKRAKFDQGEDPLDPESGKHQQGFNPYQEFHHFHGSPFQFKFH FN |
|
| |