| Protein: 328791035 XP_001119892.2 PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11 mitochondrial-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 48.5 | 51.5 | 0.94174755 | ||
| Scape | 45.7 | 13.4 | 41 | 1.1146342 | 0.32682925 |
| Brain | |||||
| Crop | 45.7 | 54.3 | 0.8416206 | ||
| Eye | |||||
| Intestine | 38.8 | 26.3 | 34.9 | 1.1117479 | 0.75358164 |
| Leg, front | 20.8 | 29.2 | 50 | 0.416 | 0.584 |
| Leg, middle | 44.4 | 22.9 | 32.7 | 1.3577982 | 0.7003058 |
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 19.3 | 32.4 | 48.3 | 0.39958593 | 0.6708075 |
| Salivary gland, thoracic | 27.9 | 46.5 | 25.6 | 1.0898438 | 1.8164062 |
| Sternite | 39.9 | 20.5 | 39.6 | 1.0075758 | 0.5176768 |
| Tergite | 52.7 | 47.3 | 1.114165 | ||
| Ventriculus | |||||
| Thoracic muscle | 46.6 | 53.4 | 0.87265915 | ||
| Fat body | 56.6 | 43.4 | 1.3041475 | ||
| Malpighian tubules | 59 | 41 | 1.4390244 | ||
| Nerve chord | 26.2 | 33.5 | 40.3 | 0.6501241 | 0.8312655 |
| Poison sac | |||||
| Sting | |||||
| Heart | 38.3 | 29.3 | 32.4 | 1.1820987 | 0.904321 |
| Hypopharyngeal gland | 82 | 18 | 4.5555553 | ||
| Galea | 73.5* | 26.5 | 2.7735848 | ||
| Glossa | 46.7 | 26.6 | 26.7 | 1.7490636 | 0.9962547 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 41 | 36.8 | 39.3 | 1.043257 | 0.93638676 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKLRIEESFNLQNPLLKDWAQREAYLQLRHREENGLPLIDPNLIDPSKFTLPSEEELVDV EIII |
 Top
| |