| Protein: 328781001 XP_393105.3 PREDICTED: circadian clock-controlled protein-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 25.8 | 23.4 | 50.9 | 0.50687623 | 0.45972496 |
| Scape | |||||
| Brain | |||||
| Crop | 43.3 | 40.8* | 15.9 | 2.7232704 | 2.5660377 |
| Eye | |||||
| Intestine | 41.7 | 29.7 | 28.6 | 1.4580419 | 1.0384616 |
| Leg, front | 39.5 | 22 | 38.5 | 1.025974 | 0.5714286 |
| Leg, middle | 10.5 | 73.5* | 16 | 0.65625 | 4.59375 |
| Leg, rear | |||||
| Mandibular gland | 5.9 | 94.1 | 0.06269926 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 52.3 | 1.2* | 46.5 | 1.1247312 | 0.025806451 |
| Sternite | |||||
| Tergite | 6.2 | 93.8 | 0.06609808 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 71.5 | 28.5 | 2.508772 | ||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33 | 31.8 | 45.9 | 0.71895427 | 0.6928105 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSFQAVVVAALCAATLVLGDYQLPATVKTCKRDSDDFSSCLRLAIQEAWPTFVPGLPEFD IPPLDPYYTESYSMEHESGQLRGKISIADVRLYGLAKSRFLSVKPEMDGDFFRLEIDVEI PKLLIDGDYKAEGSLATFKMGGKGFFNISMENIRTVWDISGHVVNDRWVVEHFKTAPTIS SMKVWFSDLFNGNEELNRAALVFINEYWPLVYRTMLPKLIEMWDTYLSEFSNRFFSKIPF STIFP |
 Top
| |