| Protein: 66516926 XP_393671.2 PREDICTED: 60S ribosomal protein L8 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 39.7 | 60.3 | 0.6583748 | ||
| Scape | 39.1 | 33 | 27.9 | 1.4014337 | 1.1827956 |
| Brain | |||||
| Crop | 29.8 | 29.8 | 40.4 | 0.73762375 | 0.73762375 |
| Eye | 52.4 | 47.6 | 1.1008403 | ||
| Intestine | 54.4* | 25.7 | 19.9 | 2.7336683 | 1.2914573 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 78.8 | 5 | 16.2 | 4.8641977 | 0.30864197 |
| Salivary gland, thoracic | 40.3 | 16 | 43.7 | 0.9221968 | 0.36613274 |
| Sternite | 85.6* | 14.4 | 5.9444447 | ||
| Tergite | 12.2 | 81.9* | 5.9 | 2.0677967 | 13.881356 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 28.7 | 31.8 | 39.5 | 0.7265823 | 0.8050633 |
| Malpighian tubules | 32.8 | 29.4 | 37.8 | 0.8677249 | 0.7777778 |
| Nerve chord | 48.7 | 11.3 | 40 | 1.2175 | 0.2825 |
| Poison sac | |||||
| Sting | 56.7 | 43.3 | 1.3094689 | ||
| Heart | 17.4 | 50.7 | 31.9 | 0.54545456 | 1.5893416 |
| Hypopharyngeal gland | 14.4 | 85.6 | 0.1682243 | ||
| Galea | |||||
| Glossa | 30.5 | 69.5 | 0.4388489 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 37.5 | 37.6 | 39 | 0.96153843 | 0.96410257 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGRVIRAQRKGAGSVFRSHTKRRKGAPKLRSLDFSERHGYIKGVVKDIIHDPGRGAPLAV VHFRDPYKFKTRKELFIAPEGMYTGQFLYCGKKANLQIGNVMPVGQMPEGTIVCNLEEKT GDRGRLARASGNYATVIAHNPDTKKTRVKLPSGAKKVIPSNNRAMVGIVAGGGRIDKPIL KAGRAYHKYKAKRNCWPKVRGVAMNPVEHPHGGGNHQHIGKASTVKRGTSAGRKIGLIAA RRTGRIRGGKTDTKKDD |
 Top
| |