| Protein: 328792943 XP_001123063.2 PREDICTED: vacuolar protein sorting-associated protein VTA1 homolog |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 49.5 | 9.7 | 40.8 | 1.2132353 | 0.23774509 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 19.6 | 44.4 | 36 | 0.54444444 | 1.2333333 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 41.8 | 35.5 | 22.7 | 1.8414097 | 1.5638766 |
| Nerve chord | 37.8 | 28.5 | 33.8 | 1.1183432 | 0.84319526 |
| Poison sac | |||||
| Sting | |||||
| Heart | 17.4 | 50.6 | 32 | 0.54375 | 1.58125 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.2 | 33.7 | 33.1 | 1.0030211 | 1.0181268 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVNLDLPEIPLSLKSLQHYLKIASTHDQRDPVISYWCRLYALQTGLKLSTKSPKETNFLM KLMDWLETTKKELYDNEAITNDIAAQAHLENWALKLFLYADKNDRAANFGKNIVHSFFTA GLLYDVLTVFGELSEEAVQNRKYAKWKAAYIHNCLKNNETPLPGPIQENNEKTNFNKNIE EDSAIEAKEEDTLNTEDLVVISNTNPSDTIYSKTSEENVEEWSSENKDCNVVTKIEGGIE LSVEQINKAQKFIKWSGSALNYDDVPTAVLNLRKALHLLTTGQELT |
 Top
| |