| Protein: 328787488 XP_001122510.2 PREDICTED: 40S ribosomal protein S26 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 57.8 | 42.2 | 1.3696682 | ||
| Scape | 59 | 41 | 1.4390244 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 82.9* | 17.1 | 4.8479533 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 39.8 | 10.8 | 49.4 | 0.805668 | 0.21862349 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 26.4 | 41.9 | 31.7 | 0.8328076 | 1.3217666 |
| Malpighian tubules | 42.1 | 27.5 | 30.4 | 1.3848684 | 0.90460527 |
| Nerve chord | 44.9 | 55.1 | 0.81488204 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 8.7 | 66.3 | 25 | 0.348 | 2.652 |
| Hypopharyngeal gland | 10.1 | 89.9 | 0.11234705 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.8 | 42.5 | 42.4 | 0.8679245 | 1.0023584 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTCKRRNGGRAKHGRGHVNPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASFYS AYQLPKLYAKLHYCVSCAIHSKVVRNRSKANRRIRTPPVRNFPRDLRQGQQSRK |
 Top
| |