| Protein: 48098427 XP_392059.1 PREDICTED: 60S ribosomal protein L26 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 53.4 | 25.3 | 21.2 | 2.518868 | 1.1933962 |
| Brain | |||||
| Crop | 36.8 | 63.2 | 0.5822785 | ||
| Eye | 60.2 | 39.8 | 1.5125629 | ||
| Intestine | 55.3 | 44.7 | 1.2371365 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 84.1 | 15.9 | 5.289308 | ||
| Salivary gland, thoracic | 38.7 | 13.3 | 48 | 0.80625 | 0.27708334 |
| Sternite | 79.5 | 20.5 | 3.878049 | ||
| Tergite | 38.8 | 50.9 | 10.3 | 3.7669902 | 4.9417477 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 27.9 | 35.4 | 36.7 | 0.76021796 | 0.9645777 |
| Malpighian tubules | 32.8 | 25.1 | 42.1 | 0.7790974 | 0.5961995 |
| Nerve chord | 56.6 | 7.2 | 36.2 | 1.5635359 | 0.19889502 |
| Poison sac | |||||
| Sting | 50 | 50 | 1 | ||
| Heart | 10.8 | 45.4 | 43.8 | 0.24657534 | 1.0365297 |
| Hypopharyngeal gland | 9.9 | 90.1 | 0.10987791 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 42.2 | 38.1 | 40.2 | 1.0497513 | 0.9477612 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKFNRLVSSSRRKNRKRHFTAPSHIRRRLMSAPLSKELRQKYNVRSMPIRKDDEVQVVRG HYKGQQVGKVVQVYRKKFVIYIERIQREKINTANVYVGIDPSKTVIVKLKMDKDRKKIID RRSKGRLAALGKDKGKYTEDSTAAMETS |
 Top
| |