| Protein: 110757726 XP_001120610.1 PREDICTED: hypothetical protein LOC725881 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | 36.8 | 63.2 | 0.5822785 | ||
| Crop | 37.9 | 62.1 | 0.61030596 | ||
| Eye | |||||
| Intestine | 23.9 | 76.1 | 0.31406045 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | 62.6 | 37.4 | 1.6737968 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 32.7 | 46.3 | 21.1 | 1.5497631 | 2.1943128 |
| Sternite | 49.9 | 50.1 | 0.996008 | ||
| Tergite | 53 | 47 | 1.1276596 | ||
| Ventriculus | |||||
| Thoracic muscle | 51.5 | 48.5 | 1.0618557 | ||
| Fat body | 32.6 | 35 | 32.5 | 1.0030769 | 1.0769231 |
| Malpighian tubules | 50.4 | 23.4 | 26.2 | 1.9236641 | 0.89312977 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 34.4 | 32.6 | 32.9 | 1.0455927 | 0.99088144 |
| Hypopharyngeal gland | 89.6 | 10.4 | 8.615385 | ||
| Galea | |||||
| Glossa | 59.6 | 40.4 | 1.4752475 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 46.5 | 41.1 | 42.1 | 1.104513 | 0.976247 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MEAKEENFSAQWALDLLEPTPLDRSNYIFKYYLAPIGGFTCIFAQVALNKIQRKPTYANK PYMLLGFLGGNLFGLFIHSIFEIKSARKDAMMRDYIIRHPEYFPKPEYKKYANILEPWTP CR |
 Top
| |