| Protein: 66533395 XP_393300.2 PREDICTED: t-complex protein 1 subunit beta-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 24.8 | 39.9 | 35.3 | 0.7025496 | 1.1303116 |
| Scape | 33.9 | 29.8 | 36.2 | 0.9364641 | 0.8232044 |
| Brain | 55.4 | 20.3 | 24.3 | 2.2798355 | 0.8353909 |
| Crop | 33.6 | 31.4 | 35 | 0.96 | 0.8971428 |
| Eye | |||||
| Intestine | 30.6 | 37.7 | 31.7 | 0.96529967 | 1.1892744 |
| Leg, front | 36.5 | 24.5 | 39 | 0.9358974 | 0.6282051 |
| Leg, middle | 43.1 | 23.1 | 33.8 | 1.2751479 | 0.6834319 |
| Leg, rear | 60.7 | 39.3 | 1.5445293 | ||
| Mandibular gland | |||||
| Rectum | 22.1 | 65.9 | 12 | 1.8416667 | 5.491667 |
| Salivary gland, cerebral | 74.9 | 25.1 | 2.9840639 | ||
| Salivary gland, thoracic | 23 | 40.8 | 36.2 | 0.6353591 | 1.1270719 |
| Sternite | |||||
| Tergite | 84 | 16 | 5.25 | ||
| Ventriculus | 21.7 | 78.3 | 0.27713922 | ||
| Thoracic muscle | |||||
| Fat body | 45.2 | 23.6 | 31.2 | 1.448718 | 0.75641024 |
| Malpighian tubules | 28 | 27.7 | 44.3 | 0.63205415 | 0.62528217 |
| Nerve chord | 29 | 31 | 40 | 0.725 | 0.775 |
| Poison sac | |||||
| Sting | 62.6 | 37.4 | 1.6737968 | ||
| Heart | 27.9 | 29.2 | 42.9 | 0.6503497 | 0.6806527 |
| Hypopharyngeal gland | 36.6 | 63.4 | 0.5772871 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 39.7 | 34.9 | 36.9 | 1.0758808 | 0.94579947 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVSLNPVRILKNEAEEEKAEIARLSLFVGAIAIGDLVKSTLGPKGMDKVLVAHGRSAGQV QVTNDGATILKNVGVDNPAAKILVDMSRVQDDEVGDGTTSVTVLAAELLREAEKLIDQKI HPQTIIAGWRNATNVAREALKNATADNSADPERFREDLLNIARTTLSSKILSQHKEHFSK LAVDAVMRLKGSGNLSAIQVIKKRGGTLADSFLDDGFLLDKKPGVHQPQRVTDARILIAN TPMDTDKIKVFGSRVRVDSMAKIAELEAAEKEKMKDKVDKIIKHGCNVFVNRQLIYNYPE QLFADANIMAIEHADFDGIERLALVTGGEIVSTFDNPDMVKLGKCDLIEQVMIGEDTLLR FSGVPLGEACTVIIRGATQQILDEAERSLHDALCVLSATVRESRIVYGGGCSEMIMACAV MRAAASTPGKESVAMESFARALQQLPTVIADNAGYDSAQLISELRAAHNSGANTMGLDME RGKVGCMKQLGVTESWAVKRQVLLSAAEAAEMILRVDDILRAAPRKRVKDRGRC |
 Top
| |