![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328791749 XP_003251627.1 PREDICTED: hypothetical protein LOC725238 |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 45.7 | 54.3 | 0.8416206 | ||
| Scape | 39.9 | 26.9 | 33.3 | 1.1981982 | 0.8078078 |
| Brain | |||||
| Crop | 34.3 | 24.4 | 41.2 | 0.8325243 | 0.592233 |
| Eye | |||||
| Intestine | 64.7 | 35.3 | 1.8328612 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 10.5 | 89.5 | 0.11731844 | ||
| Rectum | |||||
| Salivary gland, cerebral | 53 | 16.9 | 30.1 | 1.7607974 | 0.5614618 |
| Salivary gland, thoracic | 38 | 16.9 | 45 | 0.84444445 | 0.37555555 |
| Sternite | 4.4 | 44.6 | 51 | 0.08627451 | 0.8745098 |
| Tergite | 4.3 | 67.2 | 28.5 | 0.1508772 | 2.3578947 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 53.1 | 31.8 | 15.1 | 3.5165563 | 2.1059604 |
| Malpighian tubules | 27.3 | 34 | 38.7 | 0.70542634 | 0.878553 |
| Nerve chord | 78.6* | 6.5 | 14.9 | 5.275168 | 0.4362416 |
| Poison sac | 81.3 | 18.7 | 4.347594 | ||
| Sting | 49.7 | 50.3 | 0.98807156 | ||
| Heart | 15.5 | 41.5 | 43 | 0.3604651 | 0.96511626 |
| Hypopharyngeal gland | 29.7 | 70.3 | 0.4224751 | ||
| Galea | 30.2 | 41.8 | 28 | 1.0785714 | 1.4928571 |
| Glossa | 28.1 | 35.6 | 36.3 | 0.77410465 | 0.9807162 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.1 | 38.8 | 40.2 | 0.79850745 | 0.96517414 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MEDKANSGSTAVEAAENPTAPAKKPSKSKSKAQREKASHPPTSEMVNAAIKELKDRKGSS LQAIKKYIASTYKVDGEKFAPFIKRYLKSAVTSGTVVQTKGKGASGSFKLSTGKNSESSK TKKVPHPTKKSVPKKTQWVEKKTVSKKTAPAKKPATPKKAAVEKKPAPAKKSASKVAAAK PKAASEAKSMSKAKKTAKAPAAKTRTPKPKKAAAPKTVKSPAKK |
|
| |