| Protein: 48102233 XP_392756.1 PREDICTED: hypothetical protein LOC409232 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 44.3 | 35.9 | 19.8 | 2.2373738 | 1.8131313 |
| Brain | 37.9 | 62.1 | 0.61030596 | ||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 10.4 | 89.6 | 0.11607143 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 42.9 | 19.4 | 37.7 | 1.137931 | 0.51458883 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 62.4 | 37.6 | 1.6595745 | ||
| Malpighian tubules | 78.8 | 21.2 | 3.7169812 | ||
| Nerve chord | 36.1 | 25.2 | 38.8 | 0.93041235 | 0.6494845 |
| Poison sac | |||||
| Sting | |||||
| Heart | 32.2 | 34.8 | 33 | 0.9757576 | 1.0545454 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38 | 38.7 | 42.5 | 0.89411765 | 0.91058826 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKKTKDVSDEDEYSADDPEEVEGASEEEWTPEAGAESGAKKRPQREVAKKRQHSEEEEDE EEEEDEEEDDEEDEESDSDTGKKPKRKRRSKKEEDEKEDEDEEDSDDNSYNESSGETPKD FTSGAFVVAKADIGNTDGGNTDPTLWRIDGKALLQKFLPFKEDGKTLYKSTSTYSGWSVN NKDKYLAAQVTFKVQSRTETIVELHLDQHQQEVVKEEKED |
 Top
| |