| Protein: 110757985 XP_624038.2 PREDICTED: 40S ribosomal protein S15 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 46.1 | 32 | 21.9 | 2.105023 | 1.4611872 |
| Brain | |||||
| Crop | 47.4 | 52.6 | 0.9011407 | ||
| Eye | 61.7 | 38.3 | 1.6109661 | ||
| Intestine | 14.4 | 46.8 | 38.8 | 0.371134 | 1.2061856 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 72.7 | 1.1 | 26.2 | 2.7748091 | 0.041984733 |
| Salivary gland, thoracic | 35.8 | 30.6 | 33.6 | 1.0654762 | 0.91071427 |
| Sternite | 77.9 | 22.1 | 3.5248868 | ||
| Tergite | 78.7 | 21.3 | 3.6948357 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 28.6 | 39.1 | 32.3 | 0.88544893 | 1.2105263 |
| Malpighian tubules | 30.7 | 32 | 37.3 | 0.8230563 | 0.85790884 |
| Nerve chord | 38.9 | 18.8 | 42.3 | 0.91962177 | 0.44444445 |
| Poison sac | |||||
| Sting | 50.9 | 49.1 | 1.0366598 | ||
| Heart | 22.9 | 40.9 | 36.2 | 0.6325967 | 1.1298343 |
| Hypopharyngeal gland | 11.7 | 88.3 | 0.13250282 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 41 | 37.7 | 38.6 | 1.0621761 | 0.9766839 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAEAEETQKKKRTFRKFTFRGVDLDQLLDMPNEQLMVLMHARARRRFSHGLKRKSMALVK KLRKAKKETPPNEKPEIVKTHLRNMIIVPEMVGSIVGVYNGKTFNQVEIKPEMIGHYLGE FSVTYKPVKHGRPGIGATHSSRFIPLK |
 Top
| |