| Protein: 328793058 XP_624620.2 PREDICTED: 60S ribosomal protein L5 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 41.7 | 58.3 | 0.71526587 | ||
| Scape | 40.8 | 34.5 | 24.8 | 1.6451613 | 1.391129 |
| Brain | |||||
| Crop | 20.1 | 38.1 | 41.8 | 0.48086125 | 0.9114832 |
| Eye | 1* | 50 | 49 | 0.020408163 | 1.0204082 |
| Intestine | 56.8 | 43.2 | 1.3148148 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 74 | 26 | 2.8461537 | ||
| Salivary gland, thoracic | 29.6 | 34.3 | 36.1 | 0.8199446 | 0.9501385 |
| Sternite | 26.9 | 41.9 | 31.2 | 0.86217946 | 1.3429487 |
| Tergite | 25.8 | 64.1 | 10.1 | 2.5544555 | 6.3465347 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 32.6 | 33.3 | 34.1 | 0.9560117 | 0.9765396 |
| Malpighian tubules | 31.5 | 28.2 | 40.3 | 0.7816377 | 0.69975185 |
| Nerve chord | 49.1 | 10.3 | 40.7 | 1.2063882 | 0.25307125 |
| Poison sac | |||||
| Sting | 51.8 | 48.2 | 1.0746888 | ||
| Heart | 20.5 | 51.1 | 28.5 | 0.71929824 | 1.7929825 |
| Hypopharyngeal gland | 12 | 88 | 0.13636364 | ||
| Galea | 29.9 | 33.7 | 36.3 | 0.8236915 | 0.92837465 |
| Glossa | 32.1 | 67.9 | 0.47275406 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.8 | 38.8 | 41.4 | 0.76811594 | 0.93719804 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGFVKVVKNKQYFKRYQVKFRRRREGKTDYYARKRLTIQDKNKYNTPKYRLIVRLSKKYI TCQVAYSRIEGDRIVCAAYSHELPKYGIKVGLTNYASAYCTGLLLARRLLKKLGLDTLYT GTTEVTGDEYNVEELDDEGPGAFRCYLDTGLMRTTTGARVFGAMKGAVDGGLNIPHSTKR FPGYDSESKSFNADVHRQHIFGQHVANYMKTLEEDDDEAFKRQFSQYIKNGITADSIESI YKNAHEAIRANPEHTKVIKEKVPMKKRWNRAKLSLSERKNRVAQKKASFLKTLEEVEA |
 Top
| |