| Protein: 328783177 XP_397307.3 PREDICTED: 60S ribosomal protein L10a isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 41.3 | 28.2 | 30.5 | 1.3540983 | 0.9245902 |
| Brain | |||||
| Crop | 16.2 | 45 | 38.8 | 0.41752577 | 1.1597939 |
| Eye | 12.1 | 87.9 | 0.13765644 | ||
| Intestine | 48.3 | 51.7 | 0.934236 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 78 | 22 | 3.5454545 | ||
| Salivary gland, thoracic | 43.4 | 13 | 43.6 | 0.9954128 | 0.29816514 |
| Sternite | 28.4 | 40.5 | 31.1 | 0.9131833 | 1.3022509 |
| Tergite | 15.7 | 78.1* | 6.1 | 2.5737705 | 12.803279 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 38.6 | 27.5 | 33.9 | 1.138643 | 0.81120944 |
| Malpighian tubules | 42.8 | 20.6 | 36.6 | 1.1693989 | 0.56284153 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 6.5 | 58.8 | 34.7 | 0.18731989 | 1.6945245 |
| Hypopharyngeal gland | 5.7 | 94.3 | 0.060445387 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.3 | 36.6 | 42.6 | 0.75821596 | 0.85915494 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MQVCVLGDQQHCDEAKANNIPYMDAEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPR ILGPGLNKAGKFPGLLSHQESMVGKIDEVKATIKFQMKKVLCLSVAVGHVEMTPDELVQN VHLSINFLVSLLKKHWQNVRSLHIKSSMGPPQRLY |
 Top
| |