| Protein: 328788218 XP_003251085.1 PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 59.3 | 40.7 | 1.4570024 | ||
| Scape | 63.4* | 13.7 | 22.8 | 2.7807016 | 0.60087717 |
| Brain | |||||
| Crop | 42.8 | 57.2 | 0.74825174 | ||
| Eye | |||||
| Intestine | 43.9 | 20.1 | 35.9 | 1.2228413 | 0.5598886 |
| Leg, front | 15.4* | 38.8 | 45.8 | 0.33624455 | 0.8471616 |
| Leg, middle | 31.1 | 35.1 | 33.8 | 0.92011833 | 1.0384616 |
| Leg, rear | 14.3 | 47.3 | 38.4 | 0.37239584 | 1.2317709 |
| Mandibular gland | 29.8 | 70.2 | 0.42450142 | ||
| Rectum | 75.9 | 24.1 | 3.1493776 | ||
| Salivary gland, cerebral | 6 | 29.8 | 64.2 | 0.093457945 | 0.46417445 |
| Salivary gland, thoracic | 31.7 | 37.2 | 31.1 | 1.0192926 | 1.1961415 |
| Sternite | 31.1 | 23.1 | 45.8 | 0.6790393 | 0.5043668 |
| Tergite | 42.2 | 21.2 | 36.7 | 1.1498637 | 0.5776567 |
| Ventriculus | |||||
| Thoracic muscle | 19.2 | 64.3 | 16.5 | 1.1636363 | 3.8969698 |
| Fat body | 51 | 29.6 | 19.4 | 2.628866 | 1.5257732 |
| Malpighian tubules | 43.5 | 27.1 | 29.4 | 1.4795918 | 0.9217687 |
| Nerve chord | 35.4 | 14.7 | 49.9 | 0.70941883 | 0.2945892 |
| Poison sac | |||||
| Sting | 53.5 | 46.5 | 1.1505376 | ||
| Heart | 42.9 | 19.8 | 37.3 | 1.1501341 | 0.5308311 |
| Hypopharyngeal gland | 79.7 | 20.3 | 3.9261084 | ||
| Galea | 40.6 | 38.1 | 21.3 | 1.9061033 | 1.7887324 |
| Glossa | 42.7 | 19.9 | 37.4 | 1.1417112 | 0.53208554 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.1 | 36.3 | 37.5 | 0.9626667 | 0.968 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGGHGHGSSMKIPSPDIYKVEDVPELKMVQEKLAKHGLKDPWLRNEVWRYTALPGTSHTL RLFKTFTRGMLLGFAAFVVTLGIEKSLGITYEHKHDDHDHDSHH |
 Top
| |