| Protein: 66557450 XP_397056.2 PREDICTED: ras-related protein Rab-14 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 53.7 | 46.3 | 1.1598272 | ||
| Scape | 48.7 | 4.8 | 46.5 | 1.0473118 | 0.1032258 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 55.3 | 44.7 | 1.2371365 | ||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 19.6 | 80.4 | 0.24378109 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 44.6 | 14.3 | 41.1 | 1.0851581 | 0.34793186 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 11 | 34.6 | 54.4 | 0.20220588 | 0.6360294 |
| Malpighian tubules | 57.9 | 42.1 | 1.375297 | ||
| Nerve chord | 24.9 | 43.7 | 31.5 | 0.7904762 | 1.3873016 |
| Poison sac | |||||
| Sting | |||||
| Heart | 22.3 | 43.6 | 34.1 | 0.6539589 | 1.2785923 |
| Hypopharyngeal gland | 67.1 | 32.9 | 2.0395136 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.3 | 37.6 | 45.4 | 0.77753305 | 0.82819384 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSTGPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVAGQKI KLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIF LIGNKSDLEGQRDVTYEEAKQFADENGLMFVEASAKTGHNVEEAFLETAKKIFQSIQDGR LDLNAAESGVQHNPSQPGRTNLQGVSNEQQGGKDSCSC |
 Top
| |