| Protein: 66517407 XP_623050.1 PREDICTED: 40S ribosomal protein S4-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 46.2 | 53.8 | 0.85873604 | ||
| Scape | 38 | 33.8 | 28.2 | 1.3475177 | 1.1985816 |
| Brain | |||||
| Crop | 18.8 | 42.8 | 38.5 | 0.48831168 | 1.1116883 |
| Eye | 61.8 | 38.2 | 1.6178011 | ||
| Intestine | 17.5 | 48.6 | 33.9 | 0.5162242 | 1.4336283 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 72.2 | 2.1 | 25.7 | 2.8093386 | 0.08171206 |
| Salivary gland, thoracic | 31.5 | 27.8 | 40.7 | 0.77395576 | 0.6830467 |
| Sternite | 48 | 38.4 | 13.5 | 3.5555556 | 2.8444445 |
| Tergite | 55.6 | 38 | 6.5 | 8.553846 | 5.8461537 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 32.2 | 36.3 | 31.5 | 1.0222223 | 1.152381 |
| Malpighian tubules | 36.8 | 25.8 | 37.4 | 0.98395723 | 0.6898396 |
| Nerve chord | 43.9 | 13.4 | 42.7 | 1.028103 | 0.31381732 |
| Poison sac | |||||
| Sting | 50.6 | 49.4 | 1.0242915 | ||
| Heart | 21.2 | 46.7 | 32.1 | 0.66043615 | 1.4548286 |
| Hypopharyngeal gland | 13.9 | 86.1 | 0.16144018 | ||
| Galea | 51.7 | 48.3 | 1.0703933 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.9 | 35.1 | 37.9 | 1.0263852 | 0.92612135 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRESLPLVIFLRNRLKYALTNSE VTKIVMQRLIKVDGKVRTDANYPAGFMDVITINKTGEYFRLIYDVKGRFTTHRITAEEAK YKLCKVKRVQTGPKGIPFLVTHDGRTIRYPDPVIKVNDTIHLDIATGKILDSIRFDSGNL CMITGGRNLGRVGTVVSRERHPGSFDICHIKDSQGHTFATRLNNVFIIGKGTKPYISLPR DKGVKLSIAEERDKRLAAKGVN |
 Top
| |